Align 2-keto-3-deoxy-L-fuconate dehydrogenase; EC 1.1.1.- (characterized)
to candidate 207249 DVU1784 oxidoreductase, short-chain dehydrogenase/reductase family
Query= SwissProt::Q8P3K4 (300 letters) >MicrobesOnline__882:207249 Length = 253 Score = 88.6 bits (218), Expect = 1e-22 Identities = 70/212 (33%), Positives = 94/212 (44%), Gaps = 18/212 (8%) Query: 64 ITAAGAGIGRESALACARAGAHVIATDIDAAALQALAAE--SDAITTQLLDVTDA----A 117 IT A AG G A A G +I T L+ LAAE D + DV D A Sbjct: 7 ITGATAGFGEACARRFAAEGCRLIITGRRKERLEKLAAELGEDRCLPLVFDVRDRKAVEA 66 Query: 118 AITALVAAHGPFDVLFNCAGYV------HQGSILDCDEPAWRRSFSINVDAMYYTCKAVL 171 A AL A DVL N AG H+ S+ D W N+ + Y +A+L Sbjct: 67 AFAALPEAFANVDVLINNAGLALGLEPAHRASLED-----WETMIDTNLKGLMYCTRALL 121 Query: 172 PGMLERGRGSIINMSSVASSIKGVPNRFVYGVTKAAVIGLSKAIAADYVAQGVRCNAICP 231 PGM+ERG+G ++N+ S+A S P YG TKA V+ S+ + AD GVR I P Sbjct: 122 PGMVERGKGHVVNLGSIAGSYP-YPGGNTYGATKAFVMQFSRNLRADLHGTGVRVTNIEP 180 Query: 232 GTIKTPSLGQRVQALGGDEQAVWKSFTDRQPM 263 G ++ R + V+K +P+ Sbjct: 181 GLAESEFSVIRFKGDASKAAGVYKGTEPLRPV 212 Lambda K H 0.320 0.133 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 300 Length of database: 253 Length adjustment: 25 Effective length of query: 275 Effective length of database: 228 Effective search space: 62700 Effective search space used: 62700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory