GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dctM in Desulfovibrio vulgaris Hildenborough

Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate 208332 DVU2823 TRAP dicarboxylate transporter family protein

Query= SwissProt::Q9HU16
         (427 letters)



>lcl|MicrobesOnline__882:208332 DVU2823 TRAP dicarboxylate
           transporter family protein
          Length = 591

 Score =  344 bits (883), Expect = 4e-99
 Identities = 169/421 (40%), Positives = 271/421 (64%), Gaps = 3/421 (0%)

Query: 1   MTILFLFLLLFLLMFIGVPIAVSLGLSGALTILLFSPDSVRSLAIKLFETSEHYTLLAIP 60
           + +LF +  +FL   +GVPIA+ LGL+   TI+      +  +A   F + + + ++AIP
Sbjct: 171 LPVLFGYFAIFLA--VGVPIAIGLGLAALATIIAAGTLPIEYIAQVAFTSIDSFPIMAIP 228

Query: 61  FFLLSGAFMTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGS 120
           FF+ +G FM  GG++RRL+  A+  +G + GG+A+A +  CM FAA+SGS PATVAA+GS
Sbjct: 229 FFIAAGVFMGAGGLSRRLLTLADEMLGSLHGGMALATIGTCMFFAAISGSGPATVAAIGS 288

Query: 121 IAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSIVMVVYAAATETSVGKLFIAGVVPGLL 180
           + I  MV  GY + F A +V  AG +G++IPPS   VVY  + + S+GKLF+ G+VPG+L
Sbjct: 289 LTIPAMVERGYDKYFSAAVVAAAGAIGVMIPPSNPFVVYGVSAQVSIGKLFLGGIVPGVL 348

Query: 181 LGLILMVVIYIVARVKKLPAMPRV-SLREWLASARKALWGLLLMVIILGGIYSGAFTPTE 239
            GL LMV  Y  ++ +      RV +LR +  +   A W L++ VI+LGGIY G  TPTE
Sbjct: 349 TGLALMVYSYWYSKKRGWKGEVRVRNLRTFTRALWDAKWALMVPVIVLGGIYGGIMTPTE 408

Query: 240 AAAVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIPQ 299
           AAA+AA Y  FV  F++R++        ++E+   + +++ ++A A +F +++T E++P 
Sbjct: 409 AAALAAFYGLFVGCFIHRELNCGSLYDCIVEAAGTSAVVIVLMAMATIFGNIMTIEEVPT 468

Query: 300 SIASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLGI 359
           +IA+ +  L  +    L+++N++L++ G FME  A I+IL PI  PI +++G+DP+H G+
Sbjct: 469 AIATAMLNLTENKIAILMLINVLLIVIGTFMEALAAIVILTPILLPIVLKVGVDPVHFGV 528

Query: 360 IMVVNMEIGLITPPVGLNLFVTSAVTGMPLGATIRAALPWLMILLVFLIIVTYIPAVSLA 419
           IMVVN+ IG + PPVG+NLFV S V    +    +  +P + I++  L+++TY+PA+ + 
Sbjct: 529 IMVVNLAIGFVPPPVGVNLFVASGVAHAKIEHLSKVVMPLIAIMIGVLLLITYVPALPMF 588

Query: 420 L 420
           L
Sbjct: 589 L 589


Lambda     K      H
   0.330    0.144    0.425 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 613
Number of extensions: 33
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 427
Length of database: 591
Length adjustment: 34
Effective length of query: 393
Effective length of database: 557
Effective search space:   218901
Effective search space used:   218901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory