Align C4-dicarboxylate TRAP transporter large permease protein DctM (characterized)
to candidate 208936 DVU0009 DedA family protein
Query= SwissProt::Q9HU16 (427 letters) >MicrobesOnline__882:208936 Length = 426 Score = 313 bits (801), Expect = 8e-90 Identities = 171/414 (41%), Positives = 251/414 (60%), Gaps = 1/414 (0%) Query: 1 MTILFLFLLLFLLMFIGVPIAVSLGLSGALTILLFSPDSVRSLAIKLFETSEHYTLLAIP 60 MT L LF +L LL PI +++G S +L+ +L+ ++ + LLA+P Sbjct: 1 MTALVLFGMLGLLFACNAPIMLAVGASAFAALLIKGGMDPMVAVQRLYAGADSFPLLAVP 60 Query: 61 FFLLSGAFMTTGGVARRLIDFANACVGHIRGGLAIAAVLACMLFAALSGSSPATVAAVGS 120 F+ +G M+ GG+++R++ A+ VGH+ GGLA+ +V++ M FA +SGS+ A AAVGS Sbjct: 61 LFMTAGQLMSAGGISQRIVRLADTLVGHLPGGLAVVSVVSSMFFAGVSGSAAADTAAVGS 120 Query: 121 IAIAGMVRSGYPQAFGAGIVCNAGTLGILIPPSIVMVVYAAATETSVGKLFIAGVVPGLL 180 I I MV GY AF + AG++G++IPPSI M+V+ A T S+GKLF GV+PGLL Sbjct: 121 ILIPSMVARGYSPAFAGAVQAAAGSIGVVIPPSIPMIVFGALTGASIGKLFAGGVMPGLL 180 Query: 181 LGLILMVVIYIVARVKKLPAMPRVSLREWLASARKALWGLLLMVIILGGIYSGAFTPTEA 240 +G+ L W A R A W L IILGGI SG T TEA Sbjct: 181 MGITLSAWCVHEGLRSGRETRRFEPAAVWPALLR-AGWSLGAPAIILGGIISGVCTATEA 239 Query: 241 AAVAAVYSAFVALFVYRDMRLSECPKVLLESGKLTIMLMFIIANAMLFAHVLTTEQIPQS 300 AAVA VY+ V LF +R++ L P +LL++ + ++M IIA A LF V+ E+IP + Sbjct: 240 AAVAVVYAFLVGLFAHRELDLRRLPALLLDAAVTSGVVMSIIAAASLFGWVMAIERIPAA 299 Query: 301 IASWVTELGLSPWMFLLVVNIVLLIAGNFMEPSAIILILAPIFFPIAMELGIDPIHLGII 360 +A + +G WM LL VNI+LL+AG +E +A +++L P+ + +GID IHLG+I Sbjct: 300 LADAILAVGGEGWMLLLAVNILLLLAGTMLETTAALILLVPVLVQLLPRMGIDLIHLGVI 359 Query: 361 MVVNMEIGLITPPVGLNLFVTSAVTGMPLGATIRAALPWLMILLVFLIIVTYIP 414 +V+N+ IG++TPP+G+ L V+ + +PL RA LP L +L+V L++VTYIP Sbjct: 360 VVMNLSIGMLTPPLGVCLMVSCGIARVPLATLARAVLPLLAVLVVDLMLVTYIP 413 Lambda K H 0.330 0.144 0.425 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 508 Number of extensions: 31 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 427 Length of database: 426 Length adjustment: 32 Effective length of query: 395 Effective length of database: 394 Effective search space: 155630 Effective search space used: 155630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory