Align uronate dehydrogenase (EC 1.1.1.203) (characterized)
to candidate 208509 DVU2996 NAD-dependent epimerase/dehydratase family protein
Query= BRENDA::Q7CRQ0 (265 letters) >MicrobesOnline__882:208509 Length = 307 Score = 56.6 bits (135), Expect = 6e-13 Identities = 52/176 (29%), Positives = 80/176 (45%), Gaps = 20/176 (11%) Query: 1 MKRLLVTGAAGQLGRVMRERLAPMAEILRLADL---SPLD---------PAGPNEECVQC 48 M +LVTGA G +G + E LAP +++ LA SP D P EE V Sbjct: 1 MATVLVTGATGFIGSHVVEALAPRHDVVGLASSVYPSPRDAVRHVRMTLPHPDLEELVAT 60 Query: 49 DLADANAVNAMVAGCDGIVHLGGISVEKPFEQILQGNIIGLYNLYEAARAHGQPRIVFAS 108 D +V C G+ +G +S+ P G + ++ L++A R G V Sbjct: 61 LRPD------VVVHCAGVASVG-LSMHSPGVDFQSGPPV-VFQLFDAIRKAGLASKVVLL 112 Query: 109 SNHTIGYYPQTERLGPDVPARPDGLYGVSKCFGENLARMYFDKFGQETALVRIGSC 164 S+ + PQ+ +G D P P YG K E++A+ + +G +A++RI SC Sbjct: 113 SSAAVYGNPQSLPVGEDAPRAPISPYGWHKGMCEDIAQEFHGTYGIRSAVLRIFSC 168 Lambda K H 0.321 0.139 0.443 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 234 Number of extensions: 15 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 265 Length of database: 307 Length adjustment: 26 Effective length of query: 239 Effective length of database: 281 Effective search space: 67159 Effective search space used: 67159 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory