Align TRAP-type large permease component (characterized, see rationale)
to candidate 206131 DVU0705 TRAP dicarboxylate transporter, putative
Query= uniprot:Q930R2 (425 letters) >MicrobesOnline__882:206131 Length = 427 Score = 251 bits (642), Expect = 2e-71 Identities = 148/410 (36%), Positives = 229/410 (55%), Gaps = 13/410 (3%) Query: 24 LMFCGVVLMWYMGMFNTQIIAQ----------NMIAGADTFTLLAIPFFILAGELMNAGG 73 +MF GV L MG+ T IA ++ G + LLAIP FI AG + G Sbjct: 12 MMFIGVPLATAMGLSATVAIAAAKLGLLSVPISVYTGVAKYPLLAIPMFIFAGMVFERSG 71 Query: 74 LSRRIIDFAIACVGHIRGGLGIVAIMAAVIMASISGSAAADTAALAAILIPMMAKAGYNV 133 ++ R+++F +A VG +RGGL I +IM +++ ISGS AD AA+A ++IP MA AGY Sbjct: 72 VALRLVNFTVALVGPLRGGLAIASIMVCMVLGGISGSGPADAAAVAMVMIPGMAAAGYPK 131 Query: 134 PRSAGLIAAGGVIAPVIPPSMAFIVFGV-AANVSITQLFMAGIVPGLIMGIAL-VATWLL 191 SAGLIAA G A +IPPS+AFI++ V S+ LF AG++PG + GIAL + W L Sbjct: 132 AFSAGLIAAAGSTAILIPPSIAFILYSVLVPQASVPALFAAGLIPGFLAGIALIIPAWAL 191 Query: 192 VVRKDDIQPLPRTPMKERVGATGRALWALGMPVIILGGIKAGVVTPTEAAVVAAVYALFV 251 VR + A A+W L PVIILGGI++G TPTEAAV A Y LFV Sbjct: 192 SVRHGFGLVGDDASCGSILIAFKEAIWGLLAPVIILGGIRSGYFTPTEAAVAAVFYGLFV 251 Query: 252 GMVIYRELKPRDLPGVILQAAKTTAVIMFLVCAALVSSWLITAANIPSEITGFISPLIDR 311 G +YR L R + +++++A+ +AV+M ++ + V +W + + + + Sbjct: 252 GFFVYRTLTLRGIYELLVESAEVSAVVMMIIALSSVFAWAGSTLGAFEAMGNALIGISTS 311 Query: 312 PTLLMFVIMLVVLVVGTALDLTPTILILTPVLMPIIKQAGIDPVYFGVLFIMNTCIGLLT 371 T+ + ++LV+++ G LD + I P+L+P++ G + V+FGV+ M IG T Sbjct: 312 ETMTLLAVVLVLIIAGMFLDGVSILFIFIPILLPVMTHFGWNAVWFGVIMTMCLAIGQFT 371 Query: 372 PPVGVVLNVVSGVGRVPLGKVIVGVTPFLVAQILVLFLLVLFPDI-VIVP 420 PP+ + L V + + + + + + V F++A + + L+V P + +VP Sbjct: 372 PPLALNLMVTTRIADIGIEETVPWVLWFVLAMTIAMLLVVFVPQLATLVP 421 Lambda K H 0.331 0.145 0.430 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 482 Number of extensions: 29 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 425 Length of database: 427 Length adjustment: 32 Effective length of query: 393 Effective length of database: 395 Effective search space: 155235 Effective search space used: 155235 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.9 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory