Align ABC transporter substrate-binding protein (characterized, see rationale)
to candidate 206132 DVU0707 TRAP dicarboxylate family transporter
Query= uniprot:A0A165IVH1 (339 letters) >MicrobesOnline__882:206132 Length = 338 Score = 157 bits (396), Expect = 5e-43 Identities = 103/338 (30%), Positives = 174/338 (51%), Gaps = 8/338 (2%) Query: 6 RTLLAALSVAAITCSFQAAAQDFKPRIIRFGYGLNEVSNQGRATKLFAEEVEKASGGKMK 65 + + L++ + S A ++KP R L GRA + +A V + + G++ Sbjct: 2 KRFVVLLALCLVFTSLTVNAAEYKPEY-RLSTVLGPAFPWGRAAERWANLVRENTEGRIN 60 Query: 66 VRAI-GAAALGSDVQMQ-QALIGGAQEMMVGSTATLVGITKEMAIWDTPFLFNNAKEADV 123 ++ G + +G D + A+ G +M VGS+ K++ ++ PFL + K D Sbjct: 61 IKVYPGTSLVGGDQTKEFTAIRQGVIDMAVGSSINWSPQVKQLNLFSLPFLMPDEKAFDA 120 Query: 124 VLDGPVGQKVMDKLQEKGLVGLVYWENGFRNLTNSKRPVNKLEDMDGIKLRVMQNNVFLD 183 + GPV + L ++G+V L ENGFR L+NSK V D+ G+K+RV+ + +F+D Sbjct: 121 LTTGPVAADIFAILDKQGVVPLAIGENGFRELSNSKVNVTSPADLKGLKIRVVGSPIFID 180 Query: 184 SFKTLGANAVPLPFSELFTALETKTVDGQENPYNTILSSKFYEV-QKYLTVTNHVYSPWI 242 F LGAN + +++ AL TK VDGQENP + ++K + V QKYLT+ ++ P Sbjct: 181 GFTALGANPTQMSWADAQPALATKAVDGQENPLSVFNAAKLHTVEQKYLTLWGYMADPLF 240 Query: 243 VLVSKKYWDGLSKAEQKVLLDAAKKSRDFERQDTR----AEADKALADLKGKGMQVNELP 298 +VSKK W+ S+A++ ++ +AAK++ D R E D L +++ G+ V L Sbjct: 241 YVVSKKVWEEWSEADRAIVAEAAKQTAAENLIDARKGITPEDDSLLKEIEKNGVTVTRLT 300 Query: 299 AAEANRMREKLSAVNASIAANVGESLWKDVQGAVAQAR 336 + ++ V A VG+ L K + A+A +R Sbjct: 301 DEQRKPFQKATRPVFDKWAEVVGKDLVKKAEDAIAASR 338 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 339 Length of database: 338 Length adjustment: 28 Effective length of query: 311 Effective length of database: 310 Effective search space: 96410 Effective search space used: 96410 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory