Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate 206179 DVU0753 amino acid ABC transporter, ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >MicrobesOnline__882:206179 Length = 243 Score = 226 bits (577), Expect = 3e-64 Identities = 118/233 (50%), Positives = 157/233 (67%), Gaps = 10/233 (4%) Query: 26 LEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQIVLDGESIGYDDIDGK 85 L VL ++L + +G VV + G SGSGK+TL+RC+N LE Q G IV+DG ID Sbjct: 15 LHVLNDINLDIAQGEVVVICGPSGSGKSTLIRCINRLEAIQKGNIVVDG-------ID-- 65 Query: 86 RVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKLPKDEAVALAEKWLER 145 + P + RA G FQQFNL+PH+T L+N+TL V+ +P+ EA A + LE+ Sbjct: 66 -INAPRTNLTLLRAEVGFVFQQFNLYPHMTVLENITLAPTLVRNIPRAEAERTAMELLEK 124 Query: 146 VGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALDPELVGEVLNVIKGLA 205 V + ++ +PGQLSGGQQQRVAIAR +AM P +MLFDE TSALDPE++ EVL+V++ LA Sbjct: 125 VNIPDKAGAYPGQLSGGQQQRVAIARGLAMKPRIMLFDEPTSALDPEMINEVLDVMRQLA 184 Query: 206 EDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQSPRLAEFL 258 +GMTM+ VTHEM FA EV+D+++FM+QG + EQ P F PQ R EFL Sbjct: 185 REGMTMVCVTHEMGFAREVADRVIFMDQGILVEQNTPDAFFNNPQHERSREFL 237 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 174 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 243 Length adjustment: 24 Effective length of query: 239 Effective length of database: 219 Effective search space: 52341 Effective search space used: 52341 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory