Align ABC transporter for D-Glucosamine, putative ATPase component (characterized)
to candidate 206675 DVU1236 amino acid ABC transporter, ATP-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_00465 (263 letters) >MicrobesOnline__882:206675 Length = 247 Score = 249 bits (636), Expect = 4e-71 Identities = 127/249 (51%), Positives = 175/249 (70%), Gaps = 10/249 (4%) Query: 11 QPLLDIRGLRKQYGPLEVLKGVDLSMQRGNVVTLIGSSGSGKTTLLRCVNMLEEFQGGQI 70 +P++ IR + K +G L L V L +Q G V +IG SGSGK+TLLR +N LE G I Sbjct: 6 EPIISIRNVWKFFGELTALHDVSLDVQAGEKVVIIGPSGSGKSTLLRSINRLENVDKGSI 65 Query: 71 VLDGESIGYDDIDGKRVRHPEKLIARHRAMTGMAFQQFNLFPHLTALQNVTLGLLKVKKL 130 ++DG+ I +D D +R GM FQ FNLFPH T LQN+T+ ++++K+ Sbjct: 66 IVDGKDIRAEDSDINVIRQD----------LGMVFQSFNLFPHKTVLQNLTMAPMRLRKV 115 Query: 131 PKDEAVALAEKWLERVGLLERRDHFPGQLSGGQQQRVAIARAIAMNPSLMLFDEVTSALD 190 P+DEA + A L++VG+ ++ + +P LSGGQQQRVAIARA+AMNP +MLFDE TSALD Sbjct: 116 PRDEAESRALDLLKKVGISDKANVYPAMLSGGQQQRVAIARALAMNPKIMLFDEPTSALD 175 Query: 191 PELVGEVLNVIKGLAEDGMTMLLVTHEMRFAFEVSDKIVFMNQGRIEEQGPPKELFERPQ 250 PE++GEVL+V+ LA++GMTM+ VTHEM FA EV+D+I+FM+ G+I EQG P+ FE P+ Sbjct: 176 PEMIGEVLDVMVTLAKEGMTMVCVTHEMGFAREVADRIIFMDHGQILEQGTPQHFFEAPE 235 Query: 251 SPRLAEFLK 259 PRL +FL+ Sbjct: 236 HPRLQKFLQ 244 Lambda K H 0.320 0.138 0.392 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 195 Number of extensions: 8 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 247 Length adjustment: 24 Effective length of query: 239 Effective length of database: 223 Effective search space: 53297 Effective search space used: 53297 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory