Align ABC transporter for D-Glucosamine, ATPase component (characterized)
to candidate 207786 DVU2299 glycine/betaine/L-proline ABC transporter, ATP binding protein
Query= reanno::Smeli:SM_b21216 (360 letters) >MicrobesOnline__882:207786 Length = 397 Score = 164 bits (415), Expect = 4e-45 Identities = 96/265 (36%), Positives = 143/265 (53%), Gaps = 30/265 (11%) Query: 1 MSALEIRNIRKRYG---------------------EVETLKGIDIA---LESGEFLVLLG 36 MS L IRN+ K +G G+D A +E GE +V++G Sbjct: 1 MSKLSIRNLTKIFGPHPEKALGLLEQGLGKEEIHRRTSHAVGVDRASFDVEEGEIVVVMG 60 Query: 37 SSGCGKSTLLNIIAGLAEPSGGDILIGERSVLGV------HPKDRDIAMVFQSYALYPNL 90 SG GKSTL+ + L EP+ G + + R V + + R MVFQ++AL+P+ Sbjct: 61 LSGSGKSTLVRCLNRLIEPTAGTVTVDGRDVTSMPVDELRRLRQRSFGMVFQNFALFPHR 120 Query: 91 SVARNIGFGLEMRRVPQAEHDKAVRDTARLLQIENLLDRKPSQLSGGQRQRVAIGRALVR 150 +V +N FGLE VP+AE ++ + + + +P+QLSGG +QRV + RAL Sbjct: 121 TVLQNAAFGLEAMGVPRAERERQAMVSLERVGLAEWAASRPAQLSGGMQQRVGLARALSL 180 Query: 151 NPQVFLFDEPLSNLDAKLRMEMRTELKRLHQMLRTTVVYVTHDQIEAMTLATRIAVMRDG 210 +P + L DE S LD +R +M+ EL RL L+ T+V+++HD EA+ L RI +MRDG Sbjct: 181 DPDILLMDEAFSALDPLIRRDMQDELLRLQDDLQKTIVFISHDLDEALKLGDRIVLMRDG 240 Query: 211 RIEQLAAPDEVYDRPATLYVAGFVG 235 + Q+ P+++ PA YVA FVG Sbjct: 241 AVVQIGTPEDILTNPADDYVARFVG 265 Lambda K H 0.320 0.136 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 342 Number of extensions: 16 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 360 Length of database: 397 Length adjustment: 30 Effective length of query: 330 Effective length of database: 367 Effective search space: 121110 Effective search space used: 121110 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory