Align Glucosaminate ammonia-lyase; EC 4.3.1.9; D-glucosaminate dehydratase alpha-subunit; GlcNA-DH alpha subunit; GlcNADH-alpha (uncharacterized)
to candidate 209312 DVU0377 thioredoxin reductase
Query= curated2:Q93HX6 (320 letters) >MicrobesOnline__882:209312 Length = 305 Score = 140 bits (354), Expect = 3e-38 Identities = 106/311 (34%), Positives = 159/311 (51%), Gaps = 24/311 (7%) Query: 9 VIILGSGPAGYSAAVYAARANLKPLLITGMQAGGQLTTTTEVDNWPGDVHGLTGPALMER 68 +IILG G AG ++A+YAARANL+ L++ GG + T V+N P + G L +R Sbjct: 7 LIILGGGVAGMTSAIYAARANLRVLILDENACGGLVNWTKVVENMP-SYTSIGGMELAQR 65 Query: 69 MREHAERFETEI-VFDHINAVDFAAKPYTLTGDSATYTCDALIIATGASARYLGLPSEEA 127 M+E + I+++D + D YT A+I+ATG +P E A Sbjct: 66 MQEQVNNLGVTVEEAVCIDSMDLTGPEKRVEADGEVYTAKAVIVATGRKP----VPLEAA 121 Query: 128 FMGKGVSACATCDGFFYRNKPVAVVGGGNTAVEEALYLANIA-STVTLIHRRETF----R 182 + V CA CDG Y K V VVGGGN+ +E+L L + + +TL+ R + F + Sbjct: 122 GECEQVHFCAICDGAPYIGKRVLVVGGGNSGFDESLALLDQGIAELTLVERMDRFFAAQK 181 Query: 183 AEKILIDKLNARVAEGKIILKLNANLDEVLGDNMGVTGARLKNNDGSFDELKVDGVFIAI 242 A+ +L + NA + + ++ + DE L VT + G + DG+F+ + Sbjct: 182 AQDLLAARPNATLMRSTEV--VSVDYDETL---RSVTLRDVAT--GEVFTREFDGIFVFM 234 Query: 243 GHTPNTSLFEGQLTL-KDGYLVVQGGRDGNATATSVEGIFAAGDVADHVYRQAITSAGAG 301 G P T +F GQ + GY+V D N ATS+ G++AAGDV YRQ T+ G Sbjct: 235 GQKPGTEVFRGQFDMDAQGYIVT----DEN-MATSLSGVYAAGDVRQKKYRQLTTAMADG 289 Query: 302 CMAALDTERYL 312 MAAL+ ER++ Sbjct: 290 TMAALEAERFI 300 Lambda K H 0.318 0.135 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 282 Number of extensions: 16 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 320 Length of database: 305 Length adjustment: 27 Effective length of query: 293 Effective length of database: 278 Effective search space: 81454 Effective search space used: 81454 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory