Align Glucose kinase (characterized, see rationale)
to candidate 206469 DVU1035 glucokinase, putative
Query= uniprot:Q8P6M4 (344 letters) >MicrobesOnline__882:206469 Length = 354 Score = 78.2 bits (191), Expect = 3e-19 Identities = 83/272 (30%), Positives = 109/272 (40%), Gaps = 21/272 (7%) Query: 71 DSRAVDAVVIASAGVALDDGRFISNNLPWTIAPRQLRDTLGVR-AVHLVNDFEAVAYAAP 129 D+ A AG + R + N+ W I L T G+ A L+NDFEA +A Sbjct: 93 DASVTAFAAFAVAGPVEEGARCLPPNIGWHI---DLATTRGLPCAASLLNDFEAQGWACL 149 Query: 130 QMEQRAVVQLSGPTPRHAQPGGPILVVGPGTGLGAAVWINGPRQPTVLATEAGQVALASN 189 + +QL P P+ VVG GTGLG + + G VL +E G A Sbjct: 150 LPGAQQCLQL---LPGKPDATAPVAVVGAGTGLGKCLLLPGTPH-RVLPSEGGHATFAFE 205 Query: 190 DPDTAQVLRILAR--DASYLPIEHVLSGPGLRNLYLALCELHAATPIHPLPADITHAALH 247 A+ A L + VLSGPGL LY H T LP A L Sbjct: 206 GRAEAEYAAFAADRLGVGRLIGDDVLSGPGLSLLY---AYHHGET----LPPHEVAARLT 258 Query: 248 SDDALARRCLQLFCALLGSAVGDMALAYGASGGVYLAGGILPSIGQFLAASDFRERFLAK 307 D + ++ F G D AL A GGV +AGG+ + + F E F Sbjct: 259 GSDVV----VEWFARFYGRTCRDWALHTLARGGVRIAGGVAAANPMLVQHGAFAEAFFDC 314 Query: 308 GRMRPVLERIPVKLVEHGQLGVLGAASWYLQH 339 +L IPV LV + G+ GAA + L H Sbjct: 315 PTHTHLLRTIPVSLVTNADAGLWGAAIFALLH 346 Lambda K H 0.321 0.136 0.410 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 408 Number of extensions: 24 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 2 Number of HSP's successfully gapped: 1 Length of query: 344 Length of database: 354 Length adjustment: 29 Effective length of query: 315 Effective length of database: 325 Effective search space: 102375 Effective search space used: 102375 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory