Align GluC aka CGL1952, component of Glutamate porter (characterized)
to candidate 206098 DVU0674 ABC transporter, permease protein, His/Glu/Gln/Arg/opine family
Query= TCDB::P48244 (228 letters) >MicrobesOnline__882:206098 Length = 271 Score = 93.6 bits (231), Expect = 3e-24 Identities = 64/212 (30%), Positives = 113/212 (53%), Gaps = 15/212 (7%) Query: 12 LLPAFWVTIKLTIYSAIGAMIFGTILTTMRVSPVKILRTLSTAYINTVRNTPLTLVVLFC 71 LL VT+++ S + A++ + +R+S ++ R ++ Y+ +VRNTPL + + Sbjct: 69 LLQGLGVTLQVAAGSLVLALLLAAVAVALRLSCLRTGRLVARLYVESVRNTPLLVQLFVT 128 Query: 72 SFGLYQNLGLTLAGRESSTFLVDNNFRLAVLGFILYTSTFVAESLRSGINTVHFGQAEAA 131 F + GL GR +S AV+ ++ ++AE LR+GI V GQ EA+ Sbjct: 129 YFAIAPVFGL---GRMAS----------AVMALGVFEGAYMAEILRAGIAAVPQGQWEAS 175 Query: 132 RSLGLGFGATFRSIIFPQAVRAAIVPLGNTLIALTKNTTIASVIGVGEASLLMKATIENH 191 RSLG+ T+ +I PQA+R A+ PL ++L K++++AS I + E + + TI Sbjct: 176 RSLGMDEPGTYVQVILPQALRRALPPLTGQAVSLVKDSSLASAIAIHELT-MQAQTIIAE 234 Query: 192 ANMLFVVFAIFAVGFMILTLPMGLGLGKLSER 223 + F V+ + A ++ +TL + + +L ER Sbjct: 235 TFLTFEVWLLTAAIYLCVTLSLS-AVARLLER 265 Lambda K H 0.327 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 144 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 228 Length of database: 271 Length adjustment: 24 Effective length of query: 204 Effective length of database: 247 Effective search space: 50388 Effective search space used: 50388 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory