Align glycerone kinase (EC 2.7.1.29) (characterized)
to candidate 206412 DVU0980 DAK2 domain protein
Query= BRENDA::P76014 (210 letters) >MicrobesOnline__882:206412 Length = 210 Score = 221 bits (562), Expect = 1e-62 Identities = 112/204 (54%), Positives = 138/204 (67%) Query: 1 MSLSRTQIVNWLTRCGDIFSTESEYLTGLDREIGDADHGLNMNRGFSKVVEKLPAIADKD 60 M L+R ++ WL R GDI YLT LD IGDADHG+NM+RGF KV EKL A DKD Sbjct: 1 MQLTRKHVLTWLARLGDIMRENKAYLTDLDAAIGDADHGINMDRGFGKVQEKLAAFEDKD 60 Query: 61 IGFILKNTGMTLLSSVGGASGPLFGTFFIRAAQATQARQSLTLEELYQMFRDGADGVISR 120 IG ILK+TGM LLSSVGGASGPL+GTFF++A A + +L E M G G++SR Sbjct: 61 IGAILKDTGMVLLSSVGGASGPLYGTFFMKAGLAVAGKDTLDATETLTMLEAGVAGLVSR 120 Query: 121 GKAEPGDKTMCDVWVPVVESLRQSSEQNLSVPVALEAASSIAESAAQSTITMQARKGRAS 180 G+ DKTM D W P +++ R + + + +AL+AA A ++TI MQARKGRAS Sbjct: 121 GRPVLQDKTMYDAWAPALDAFRAALGKGDDLALALDAAVDAAGEGMRATIPMQARKGRAS 180 Query: 181 YLGERSIGHQDPGATSVMFMMQML 204 YLGERSIGHQDPGATS +FM+ L Sbjct: 181 YLGERSIGHQDPGATSTVFMLTAL 204 Lambda K H 0.316 0.130 0.364 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 3 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 210 Length of database: 210 Length adjustment: 21 Effective length of query: 189 Effective length of database: 189 Effective search space: 35721 Effective search space used: 35721 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory