GapMind for catabolism of small carbon sources

 

Aligments for a candidate for dhaM in Desulfovibrio vulgaris Hildenborough

Align PEP-dependent dihydroxyacetone kinase, phosphoryl donor subunit DhaM; Dihydroxyacetone kinase subunit M; EC 2.7.1.121 (characterized)
to candidate 206413 DVU0981 multiphosphoryl transfer protein, putative

Query= SwissProt::D4GL26
         (473 letters)



>lcl|MicrobesOnline__882:206413 DVU0981 multiphosphoryl transfer
           protein, putative
          Length = 854

 Score =  292 bits (747), Expect = 3e-83
 Identities = 197/507 (38%), Positives = 272/507 (53%), Gaps = 45/507 (8%)

Query: 1   MVNLVIVSHSAMLGEGVEMLARQMLTGDNCRIAVAAGIDDPDHPIGTDPIKVMEAIEAVA 60
           MV +V+V+HSA+LG+G+  LA QM  G    +AVA GIDDPDHPIGTDP++VM AIE V 
Sbjct: 1   MVGIVVVTHSAVLGQGLRELAEQMTQG-RVPLAVAGGIDDPDHPIGTDPVRVMTAIEEVQ 59

Query: 61  DTDHVLVMMDMGSALLSAETALDLLDPVIAEKVRLCAAPLVEGTLAATVSAAAGADIDTV 120
             D VLV+MD+GSAL+SAETALDLL P +A +VRL AAPLVEG +AA V A+ GAD+  V
Sbjct: 60  QGDGVLVLMDLGSALMSAETALDLLPPEVASQVRLSAAPLVEGLMAAAVLASTGADLGAV 119

Query: 121 IDVAMNALAAKQAQLGITPPAHAASLPAQAPDSDARS------------VTVTIRNHHGL 168
            + A +ALAAK+  LG   PA A ++P+  P+    S            +T+ + N  GL
Sbjct: 120 AEEAQSALAAKRELLGAAAPA-APAMPSAHPEGARDSTVPSSAMPAGEELTLVVPNRLGL 178

Query: 169 HVRPASRLVAALAGMNADLVLEKQGQCVKPDSLNQIALLQVRCHDAVTLSASGPDAERAL 228
           H RPA+R+V AL    AD+ L +  + V   S+N+IA L VR  + VT  A G DA  AL
Sbjct: 179 HARPAARIVTALGPFAADVQLVRGDRVVSARSVNRIATLAVRGGETVTFRAVGGDAALAL 238

Query: 229 AAFESLAAEDFGEHPESMA------------------------------LKTSASTVEKV 258
            A E+LAA  FG+ PE+ +                              L+ +A++    
Sbjct: 239 RAIEALAAAHFGDAPEAPSKGEAPSPAEAPKDGDMAEAAVSADVQGGGVLRGAAASPGLT 298

Query: 259 QGKAVFYPLPLAQPARHP-CSDVGQEERRLQQAIVDTLNDLNALAALAEKKYGASVAAIF 317
            G AV+Y      P   P   D   E  RL  A+     +L  L        G   A IF
Sbjct: 299 VGNAVWYRPAFDAPDVAPLADDPATEVTRLDAALGAARTELVELERRTVAAAGRKEAEIF 358

Query: 318 SGHYTLLDDPDLFDAACKVIRNDSCCAESAWYQVLMELSQQYQHLDDAYLQARFIDIEDI 377
           + H  LLDD  +  AA + I +    AESAWY+V+ + +  ++ L + Y++ R  D+ D+
Sbjct: 359 AMHRLLLDDVTIAGAARQRIMDRREAAESAWYEVISDAAATFRQLPEGYMREREADMVDV 418

Query: 378 LYRSLCHLKGRDIRLPTPDVPAIIVADDIFPSAVVNLNAQLVKGICLREGSTLSHAAIIA 437
             R L  L G     P    P++++A D+ PS +  L+  LV GI   +G   SHAAI+A
Sbjct: 419 GARVLRLLTGVAAVGPRLGGPSVLLATDLGPSDMATLDPSLVIGIVTVQGGATSHAAILA 478

Query: 438 QQAGIAFICQQGAVLDIIQPEDRLLID 464
           +  GI  +   G  L  +   D + +D
Sbjct: 479 RSLGIPAVAGLGPALQGVGEGDIVALD 505


Lambda     K      H
   0.320    0.133    0.380 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 862
Number of extensions: 37
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 473
Length of database: 854
Length adjustment: 38
Effective length of query: 435
Effective length of database: 816
Effective search space:   354960
Effective search space used:   354960
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory