Align GlpT, component of Glycerol uptake porter, GlpSTPQV (characterized)
to candidate 208681 DVU3161 ABC transporter, ATP-binding protein
Query= TCDB::G3LHY9 (356 letters) >MicrobesOnline__882:208681 Length = 349 Score = 205 bits (521), Expect = 2e-57 Identities = 124/342 (36%), Positives = 189/342 (55%), Gaps = 22/342 (6%) Query: 1 MARITLDHIRHAYGANPKSDKDYSLKEVDHEWNDGGAYALLGPSGCGKTTLLNIISGLLQ 60 M+ I LD + +G D +V E G LLGPSGCGK+T L +I+GL Sbjct: 1 MSTIVLDKVSRHWGDVRAVD------DVSFEVEQGDMLVLLGPSGCGKSTTLRLIAGLES 54 Query: 61 PSHGRILFDGKDVTNLSTQSRNIAQVFQFPVIYDTMTVYDNLAFPLRNRGVAEADVDRRV 120 + GRIL G+DVTNL R +A VFQ ++ +TV DN+ F L R V A+ +R+ Sbjct: 55 VTSGRILIGGRDVTNLPPAQRQLAMVFQSYALFPHLTVRDNILFGLVVRKVPAAERQKRL 114 Query: 121 RDILEMIDLASWARRKAQGLTADQKQKISLGRGLVRNDVNAILFDEPLTVIDPHMKWVLR 180 +E++ L RK L+ Q+Q+++LGR LV + L DEPL+ +D ++ +R Sbjct: 115 DRAVEILGLGKLLERKPGELSGGQQQRVALGRALVA-EAAVCLMDEPLSNLDAKLRQEMR 173 Query: 181 SQLKRLHKQFGFTMVYVTHDQTEALTFAEKVVVMYDGQIVQIGTPAELFERPSHTFVGYF 240 +++ L + G TMVYVTHDQTEA++ A+++++M G+IVQ TP E++ RP+ F G F Sbjct: 174 REIRALQQTLGMTMVYVTHDQTEAMSMADRIILMQGGRIVQNATPTEMYSRPATAFAGSF 233 Query: 241 IGSPGMNFMPARIEGSTVKVGDETLTLEYAPKTSGT------AKTELGIRPEFIRLGREG 294 IG+P MN + R++G+ D+ + + A SG A LGIRPE IR+ +G Sbjct: 234 IGTPPMNLV--RLQGN-----DDGIRV--AGSRSGRVTCHAGADCMLGIRPEHIRIVDDG 284 Query: 295 MPITISKVEDIGRQKIVRARFADQPIAIVVPEDADIPADARV 336 + VE +G ++ R + +++VV D A + Sbjct: 285 WRAVVESVEYLGSNSVLSCRVGSEELSVVVHGVTDTVVGAEI 326 Lambda K H 0.321 0.137 0.405 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 356 Length of database: 349 Length adjustment: 29 Effective length of query: 327 Effective length of database: 320 Effective search space: 104640 Effective search space used: 104640 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory