Align ABC transporter for L-Histidine, permease component 1 (characterized)
to candidate 209036 DVU0106 glutamine ABC transporter, permease protein
Query= reanno::acidovorax_3H11:Ac3H11_2554 (222 letters) >MicrobesOnline__882:209036 Length = 223 Score = 172 bits (435), Expect = 6e-48 Identities = 93/216 (43%), Positives = 141/216 (65%), Gaps = 6/216 (2%) Query: 1 MELDFSP--VWAGVPQLLAGALVTVEITAASLLLGCVMGLLVGIGRLNPKRRVVYAL-CT 57 M DF P + P LLAG +TV IT L LG ++G + G+ N R+ + + T Sbjct: 1 MAFDFQPQVMLDTAPLLLAGVKLTVLITLGGLALGFLLGAVAGLA--NSGRKAAFKVPAT 58 Query: 58 AYVAAIRGTPLLVQLFILFFGLP-QFGILLPAFVCGVIGLGIYSGAYVSEVVRGAIQSID 116 Y+ AIRGTPL+VQ+ L+FG+P G+ +P G++ + + SGAY++E+VRGAI SID Sbjct: 59 IYIEAIRGTPLIVQVMFLYFGVPLATGMRIPPETAGILAIAVNSGAYIAEIVRGAIASID 118 Query: 117 KGQMEAARSIGMSSGLAMRTVVLPQAVVRMIPPLGNEFIALIKNSALVSLLTIHDLMHEG 176 GQ EA RSIG++ M ++ PQA RMIPPLGN+FI +K+++L+ ++ + +L +G Sbjct: 119 TGQSEAGRSIGLTRLQTMLYIIWPQAFRRMIPPLGNQFIISLKDTSLLVVIGVGELTRQG 178 Query: 177 QKIISVSYRSLEVYLAIAVVYFILTGATTLVLRRIE 212 Q+II+V++R+ EV+L +AV Y +T + LRR+E Sbjct: 179 QEIIAVNFRAFEVWLTVAVFYLAMTLSIAWALRRLE 214 Lambda K H 0.328 0.143 0.412 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 147 Number of extensions: 5 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 222 Length of database: 223 Length adjustment: 22 Effective length of query: 200 Effective length of database: 201 Effective search space: 40200 Effective search space used: 40200 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 45 (21.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory