Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate 207786 DVU2299 glycine/betaine/L-proline ABC transporter, ATP binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >MicrobesOnline__882:207786 Length = 397 Score = 149 bits (375), Expect = 1e-40 Identities = 92/236 (38%), Positives = 136/236 (57%), Gaps = 28/236 (11%) Query: 1 MSSVSIQAVSRVF----ETAKG------------QRTQALQPVD---FEVRDNDFVTILG 41 MS +SI+ ++++F E A G +RT VD F+V + + V ++G Sbjct: 1 MSKLSIRNLTKIFGPHPEKALGLLEQGLGKEEIHRRTSHAVGVDRASFDVEEGEIVVVMG 60 Query: 42 PSGCGKSTLLRIVAGLDHATSGRVLLDGAPVEGPGAER---------GMVFQSYTLFPWL 92 SG GKSTL+R + L T+G V +DG V + GMVFQ++ LFP Sbjct: 61 LSGSGKSTLVRCLNRLIEPTAGTVTVDGRDVTSMPVDELRRLRQRSFGMVFQNFALFPHR 120 Query: 93 TIEQNIRFGLRERGMPEAQQKERAAYFIAKVGLRGFEQHFPKQLSGGMQQRTAIARALAN 152 T+ QN FGL G+P A+++ +A + +VGL + P QLSGGMQQR +ARAL+ Sbjct: 121 TVLQNAAFGLEAMGVPRAERERQAMVSLERVGLAEWAASRPAQLSGGMQQRVGLARALSL 180 Query: 153 DPKILLMDEPFGALDNQTRVLMQELLLGIWEAERKTVLFVTHDIDEAIFMANRVAV 208 DP ILLMDE F ALD R MQ+ LL + + +KT++F++HD+DEA+ + +R+ + Sbjct: 181 DPDILLMDEAFSALDPLIRRDMQDELLRLQDDLQKTIVFISHDLDEALKLGDRIVL 236 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 268 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 397 Length adjustment: 28 Effective length of query: 231 Effective length of database: 369 Effective search space: 85239 Effective search space used: 85239 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory