Align ABC transporter for L-Histidine, ATPase component (characterized)
to candidate 209701 DVUA0022 ABC transporter, ATP-binding protein
Query= reanno::acidovorax_3H11:Ac3H11_2560 (259 letters) >MicrobesOnline__882:209701 Length = 228 Score = 140 bits (354), Expect = 2e-38 Identities = 89/224 (39%), Positives = 123/224 (54%), Gaps = 15/224 (6%) Query: 4 VSIQAVSRVFETAKGQRTQ-ALQPVDFEVRDNDFVTILGPSGCGKSTLLRIVAGLDHATS 62 + + VS VF G+ Q AL+ V VRD + + + GPSG GK+TLL I+ G+ T Sbjct: 7 LEVHGVSMVF--GAGENAQYALRDVHLSVRDGEVLMLRGPSGSGKTTLLSIMGGILSPTE 64 Query: 63 GRVLLDGAPVEGPGAER---------GMVFQSYTLFPWLTIEQNIRFGLRERGMPEAQQK 113 G + +DG P+ G AE G +FQ Y LFP LT QNI+ L RG+P + + Sbjct: 65 GTLTVDGTPMTGLSAEARSALRLKHFGFIFQDYNLFPTLTCSQNIQVALDLRGVPRDEAR 124 Query: 114 ERAAYFIAKVGLRGFEQHFPKQLSGGMQQRTAIARALANDPKILLMDEPFGALDNQTRVL 173 A + +VGL G P +LSGG +QR A+ARALA P ++L DEP ALD+ ++ Sbjct: 125 RIADATLGEVGLGGKVGEMPARLSGGQKQRLAVARALAGSPMVMLADEPTAALDSTNGLM 184 Query: 174 MQELLLGIWEAERKTVLFVTHDIDEAIFMANRVAVFSARPGRIK 217 + LL + A + V+ VTHD D + A+RV GRIK Sbjct: 185 IMSLLRDLAHAGGRAVVVVTHD-DRIMPFADRVV--HIEDGRIK 225 Lambda K H 0.322 0.136 0.394 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 139 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 259 Length of database: 228 Length adjustment: 23 Effective length of query: 236 Effective length of database: 205 Effective search space: 48380 Effective search space used: 48380 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory