Align ABC transporter related (characterized, see rationale)
to candidate 206675 DVU1236 amino acid ABC transporter, ATP-binding protein
Query= uniprot:B2TBJ9 (263 letters) >MicrobesOnline__882:206675 Length = 247 Score = 241 bits (615), Expect = 1e-68 Identities = 126/254 (49%), Positives = 173/254 (68%), Gaps = 11/254 (4%) Query: 1 MNATAPVALSVKNIHKSFGDHHVLKGISLDAHQGDVISILGASGSGKSTFLRCLNLLETP 60 M A +S++N+ K FG+ L +SLD G+ + I+G SGSGKST LR +N LE Sbjct: 1 MTAANEPIISIRNVWKFFGELTALHDVSLDVQAGEKVVIIGPSGSGKSTLLRSINRLENV 60 Query: 61 DDGSVSLAGEELKMKRRGDGKLQPSDRRQVDRVRSQLGMVFQNFNLWSHMTVLENLIEGP 120 D GS+ + G++++ ++ ++ +R LGMVFQ+FNL+ H TVL+NL P Sbjct: 61 DKGSIIVDGKDIR-----------AEDSDINVIRQDLGMVFQSFNLFPHKTVLQNLTMAP 109 Query: 121 MRVQKRSRAESVEEAEALLAKVGLAEKRGHYPAHLSGGQQQRVAIARALAMHPKVMLFDE 180 MR++K R E+ A LL KVG+++K YPA LSGGQQQRVAIARALAM+PK+MLFDE Sbjct: 110 MRLRKVPRDEAESRALDLLKKVGISDKANVYPAMLSGGQQQRVAIARALAMNPKIMLFDE 169 Query: 181 PTSALDPELVGEVLRVMRSLAEEGRTMLVVTHEMGFARHVSNRVMFLHQGQVEADGTPDE 240 PTSALDPE++GEVL VM +LA+EG TM+ VTHEMGFAR V++R++F+ GQ+ GTP Sbjct: 170 PTSALDPEMIGEVLDVMVTLAKEGMTMVCVTHEMGFAREVADRIIFMDHGQILEQGTPQH 229 Query: 241 VFVECKSDRFRQFV 254 F + R ++F+ Sbjct: 230 FFEAPEHPRLQKFL 243 Lambda K H 0.318 0.133 0.377 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 180 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 263 Length of database: 247 Length adjustment: 24 Effective length of query: 239 Effective length of database: 223 Effective search space: 53297 Effective search space used: 53297 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory