Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate 207079 DVU1627 ABC transporter, ATP-binding protein
Query= uniprot:Q1MCU2 (292 letters) >MicrobesOnline__882:207079 Length = 241 Score = 128 bits (322), Expect = 1e-34 Identities = 85/263 (32%), Positives = 135/263 (51%), Gaps = 31/263 (11%) Query: 14 LLKVEHLSMKFGGLMAINDFSFEAKRGDITALIGPNGAGKTTVFNCITGFYKPTMGMITF 73 +L+ E L +FG + S ++G+I L+GPNGAGKTT F +TG KPT G++ Sbjct: 4 VLQGEDLRKRFGQREVVRGVSVSVQQGEIVGLLGPNGAGKTTTFYMLTGIIKPTAGIVRL 63 Query: 74 NQKSGKQYLLERLPDFRITKEARVARTF--QNIRLFSGLTVLENL-LVAQHNKLMKASGY 130 + + + D+ + + ARV ++ Q +F LTV ENL ++ +H L A Sbjct: 64 DGQD--------IADWPLHERARVGLSYLPQESSVFKRLTVRENLEIILEHTGLPAAR-- 113 Query: 131 TILGLIGVGPYKREAAEAIELARFWLEKADLIDRADDPAGDLPYGAQRRLEIARAMCTGP 190 ++E AEA+ +A F + A A L G +RRLEIAR M P Sbjct: 114 -----------QKERAEAL-MADF-----GIAHLASSRAMHLSGGERRRLEIARCMIREP 156 Query: 191 ELLCLDEPAAGLNPRESATLNALLKSIRAETGTSILLIEHDMSVVMEISDHVVVLEYGQK 250 + + LDEP AG++P + L++ +R + G +L+ +H++ + I D ++ GQ Sbjct: 157 KFVLLDEPFAGIDPLAVGDIQGLIRKLR-DRGIGVLISDHNVRETLTICDRAYLVHQGQV 215 Query: 251 ISDGTPDHVKNDPRVIAAYLGVE 273 I DGTP+H+ D + YLG + Sbjct: 216 ILDGTPEHIVGDEQARLVYLGAD 238 Lambda K H 0.318 0.136 0.386 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 192 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 292 Length of database: 241 Length adjustment: 25 Effective length of query: 267 Effective length of database: 216 Effective search space: 57672 Effective search space used: 57672 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory