Align ATP-binding component of a broad range amino acid ABC transporter (characterized, see rationale)
to candidate 207079 DVU1627 ABC transporter, ATP-binding protein
Query= uniprot:Q1MCU3 (247 letters) >MicrobesOnline__882:207079 Length = 241 Score = 129 bits (323), Expect = 7e-35 Identities = 81/235 (34%), Positives = 125/235 (53%), Gaps = 6/235 (2%) Query: 11 LLQVNGVETYYGNIRALAGVDVHVNKGEIVSLIGANGAGKSTLMMTICGSPQARTGSVVF 70 +LQ + +G + GV V V +GEIV L+G NGAGK+T + G + G V Sbjct: 4 VLQGEDLRKRFGQREVVRGVSVSVQQGEIVGLLGPNGAGKTTTFYMLTGIIKPTAGIVRL 63 Query: 71 EGRDITRMPTHEIARLRIAQSPEGRRIFPRMTVLENLQM---GAGLDNLKHFAEDVEKIF 127 +G+DI P HE AR+ ++ P+ +F R+TV ENL++ GL + E E + Sbjct: 64 DGQDIADWPLHERARVGLSYLPQESSVFKRLTVRENLEIILEHTGLPAARQ-KERAEALM 122 Query: 128 TLFPRLKERHAQRGGTLSGGEQQMLSIGRALMARPKLLLLDEPSLGLAPLIVKGIFEAIR 187 F + + R LSGGE++ L I R ++ PK +LLDEP G+ PL V I IR Sbjct: 123 ADF-GIAHLASSRAMHLSGGERRRLEIARCMIREPKFVLLDEPFAGIDPLAVGDIQGLIR 181 Query: 188 KLNEAEGLTVFLVEQNAFAALRLSHRAYVMVNGKVTMSGSGKELLANPEVRAAYL 242 KL + G+ V + + N L + RAY++ G+V + G+ + ++ + + R YL Sbjct: 182 KLRD-RGIGVLISDHNVRETLTICDRAYLVHQGQVILDGTPEHIVGDEQARLVYL 235 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 157 Number of extensions: 6 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 247 Length of database: 241 Length adjustment: 24 Effective length of query: 223 Effective length of database: 217 Effective search space: 48391 Effective search space used: 48391 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory