Align HutV aka HISV aka R02702 aka SMC00670, component of Uptake system for hisitidine, proline, proline-betaine and glycine-betaine (characterized)
to candidate 206400 DVU0968 amino acid ABC transporter, ATP-binding protein
Query= TCDB::Q9KKE1 (275 letters) >MicrobesOnline__882:206400 Length = 246 Score = 153 bits (386), Expect = 4e-42 Identities = 89/218 (40%), Positives = 132/218 (60%), Gaps = 10/218 (4%) Query: 43 LNDVSLKIGAGKIFVIMGLSGSGKSTLVRHINRLIEPTSGEVLFDGDNILDLGAKALRAF 102 L DVSL + G++ VI+G SGSGKST +R +NRL SGE+L +G +ILD + Sbjct: 22 LRDVSLDVAPGEVVVIIGPSGSGKSTFLRCLNRLEYADSGEILIEGRDILDPKCEINEV- 80 Query: 103 RMRRVSMVFQSFALMPHRTVLQNVVYGQR-VRGVSKDDAREIGMKWIDTVGLSGYDAKFP 161 V MVFQSF L PH +VL+NV Q VR S+ ++ + GM+ + VG++ A +P Sbjct: 81 -RAEVGMVFQSFNLFPHLSVLENVALAQMTVRKRSRAESEKKGMELLTKVGIADKHAVYP 139 Query: 162 HQLSGGMKQRVGLARALAADTDVILMDEAFSALDPLIRGDMQDQLLQLQRNLAK---TIV 218 QLSGG +QRV +AR+LA D ++L DE SALDP +M ++L + RNLA+ T+V Sbjct: 140 DQLSGGQQQRVAIARSLAMDPKIMLFDEPTSALDP----EMVGEVLDVMRNLAREGMTMV 195 Query: 219 FITHDLDEALRIGSEIAILRDGQVVQVGTPNDILDNPA 256 +TH++ A + + + G ++++ TP D+ A Sbjct: 196 VVTHEMGFAREVADRVVFMDHGAILEIATPKDLFTTGA 233 Lambda K H 0.323 0.139 0.397 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 186 Number of extensions: 8 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 275 Length of database: 246 Length adjustment: 24 Effective length of query: 251 Effective length of database: 222 Effective search space: 55722 Effective search space used: 55722 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory