Align NatD aka LivH aka SLR0949, component of Leucine/proline/alanine/serine/glycine (and possibly histidine) porter, NatABCDE (characterized)
to candidate 206138 DVU0713 branched-chain amino acid ABC transporter, permease protein
Query= TCDB::P74318 (286 letters) >MicrobesOnline__882:206138 Length = 301 Score = 169 bits (428), Expect = 7e-47 Identities = 102/291 (35%), Positives = 167/291 (57%), Gaps = 18/291 (6%) Query: 5 QLIFNGIAVGSIIALGAVGLTLTYGILRLSNFAHGDFMTLAAYLTWW--------ANTSG 56 Q + NG+AVG I AL A+G T+ YG+L+L NFAHGD T+ AYL + + SG Sbjct: 6 QQLTNGLAVGGIYALIALGYTMVYGVLKLINFAHGDLFTIGAYLGFTVFAALGLSGHVSG 65 Query: 57 ---INLWLSMALGCVGTIIAMFIGEWLLWKPMRARRATATTLIIISIGLALFLRNGILLI 113 + L +M +G V I ++ E + ++P+R+ ++ + ++ ++G ++F +N ++LI Sbjct: 66 AVAVLLVTTMVMGLVALI--GYLLERVAYRPLRS--SSRLSAVVSALGASIFFQNAVMLI 121 Query: 114 WGGNNQNYRVPIVP--AQDFMGIKFEYYRLLVIAMAIAAMVVLHLILQRTKVGKAMRAVA 171 +G Q Y I P A F G+ R+++ ++A M++LH + RT+ G A+RAVA Sbjct: 122 YGAKFQVYPNDIRPTMAVSFFGMDIPLVRIMMFGASVALMLLLHFFIHRTRTGTAIRAVA 181 Query: 172 DNVDLAKVSGINVEWVVMWTWVMTAVLTALGGSMYGL-MTTLKPNMGWFLILPMFASVIL 230 + AK+ GI+V V+ +++ L G M GL + MGW L F + IL Sbjct: 182 IDQGAAKLMGIDVNRVIALVFMIGPALGGAAGVMVGLYYGQIDFTMGWVYGLKAFTAAIL 241 Query: 231 GGIGNPYGAIAGGIIIGVAQEVSVPWFGTSYKMGVALLLMIIILFIRPQGL 281 GGIGN GA+ GG+++GV + + + ++K +A L++I+IL IRP GL Sbjct: 242 GGIGNIPGAMVGGLLLGVIEALGAAYISIAWKDAIAFLVLILILIIRPTGL 292 Lambda K H 0.329 0.143 0.450 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 223 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 286 Length of database: 301 Length adjustment: 26 Effective length of query: 260 Effective length of database: 275 Effective search space: 71500 Effective search space used: 71500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory