Align monosaccharide-transporting ATPase (EC 3.6.3.17) (characterized)
to candidate 209027 DVU0098 polyamine ABC transporter, ATP-binding protein
Query= BRENDA::Q97UY8 (353 letters) >MicrobesOnline__882:209027 Length = 368 Score = 210 bits (535), Expect = 4e-59 Identities = 112/291 (38%), Positives = 180/291 (61%), Gaps = 18/291 (6%) Query: 4 IIVKNVSKVFKKGKVVALDNVNINIENGERFGILGPSGAGKTTFMRIIAGLDVPSTGELY 63 I ++ V+K F+ ALDN+++ I NGE +LGPSG GKTT +R+I+G + P G + Sbjct: 8 IELRGVTKNFED--TCALDNIDLEIRNGEFLTLLGPSGCGKTTILRLISGFEKPDAGVIT 65 Query: 64 FDDRLVASNGKLIVPPEDRKIGMVFQTWALYPNLTAFENIAFPLTNMKMSKEEIRKRVEE 123 + + PPE R++ VFQ +AL+P+++ EN+ F L + K+EI +RV + Sbjct: 66 LKGQRMDD-----APPEARQVNTVFQNYALFPHMSVRENVGFGLRMQRRPKDEIARRVHD 120 Query: 124 VAKILDIHHVLNHFPRELSGGQQQRVALARALVKDPSLLLLDEPFSNLDARMRDSARALV 183 +++ + + PR+LSGGQQQRVA+ARA+V +P +LLLDEPFS LD ++R + + Sbjct: 121 ALRMVHLEAHADRRPRQLSGGQQQRVAIARAVVNNPLVLLLDEPFSALDYKLRKQMQLEI 180 Query: 184 KEVQSRLGVTLLVVSHDPADIFAIADRVGVLVKGKLVQVGKPEDLYDNPVSIQVASLIGE 243 K +Q +LG+T + V+HD + FA++DRV V+ GK+ Q+G P+++Y+ P ++ VA +GE Sbjct: 181 KHLQRQLGITFVFVTHDQEEAFAMSDRVVVMNDGKIEQIGSPQEIYEEPANLYVARFVGE 240 Query: 244 INELEGKV-TNEG-----VVIGSLRFPVS-----VSSDRAIIGIRPEDVKL 283 IN L + N G VI + FP+ D+ + +RPED+++ Sbjct: 241 INILNAVIAANHGDGLYDAVIEGVTFPIRSQRTFAPGDKVNVLLRPEDLRV 291 Lambda K H 0.319 0.139 0.390 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 334 Number of extensions: 20 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 353 Length of database: 368 Length adjustment: 29 Effective length of query: 324 Effective length of database: 339 Effective search space: 109836 Effective search space used: 109836 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory