GapMind for catabolism of small carbon sources

 

Aligments for a candidate for tpi in Desulfovibrio vulgaris Hildenborough

Align Triosephosphate isomerase; TIM; TPI; Triose-phosphate isomerase; EC 5.3.1.1 (characterized)
to candidate 207136 DVU1677 triosephosphate isomerase

Query= SwissProt::P00943
         (253 letters)



>lcl|MicrobesOnline__882:207136 DVU1677 triosephosphate isomerase
          Length = 251

 Score =  194 bits (493), Expect = 1e-54
 Identities = 113/253 (44%), Positives = 154/253 (60%), Gaps = 9/253 (3%)

Query: 3   KPIIAGNWKMHKTLAEAV----QFVEDVKGHVPPADEVISVVCAPFLFLDRLVQA-ADGT 57
           K +IA NWKM+KT+ EA     + V  V G +P   EV+  VC PF  L  L     D  
Sbjct: 2   KKLIAANWKMYKTIDEARATGRELVSAVAGSLPADREVL--VCPPFTALHALHDTFKDVE 59

Query: 58  DLKIGAQTMHFADQGAYTGEVSPVMLKDLGVTYVILGHSERRQMFAETDETVNKKVLAAF 117
              IG Q ++ A +GAYTGE++P ML D G  +V+ GHSERR +  E DETV +K   + 
Sbjct: 60  GFAIGGQDVYPATEGAYTGEIAPGMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSL 119

Query: 118 TRGLIPIICCGESLEEREAGQTNAVVASQVEKALAGLTPEQVKQA-VIAYEPIWAIGTGK 176
             GL  ++C GE L+EREAG+   V+A Q++  LA +    V Q+ V+AYEP+WAIGTGK
Sbjct: 120 KAGLRVVLCIGEKLDEREAGRLEDVLAHQLQVGLADVDATYVPQSLVVAYEPVWAIGTGK 179

Query: 177 SSTPEDANSVCGHIRSVVSRLFGPEAAEAIRIQYGGSVKPDNIRDFLAQQQIDGPLVGGA 236
            + P +       +RS++   +G + A AIRI YGGSVKPDN  + L+   +DG LVGGA
Sbjct: 180 VAGPAEVVEAHALVRSLLEARYGRDGA-AIRILYGGSVKPDNAAELLSLDNVDGLLVGGA 238

Query: 237 SLEPASFLQLVEA 249
           SL+  SF +++ A
Sbjct: 239 SLQAVSFSRIILA 251


Lambda     K      H
   0.318    0.134    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 197
Number of extensions: 10
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 253
Length of database: 251
Length adjustment: 24
Effective length of query: 229
Effective length of database: 227
Effective search space:    51983
Effective search space used:    51983
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 46 (22.3 bits)

Align candidate 207136 DVU1677 (triosephosphate isomerase)
to HMM TIGR00419 (tpiA: triose-phosphate isomerase (EC 5.3.1.1))

# hmmsearch :: search profile(s) against a sequence database
# HMMER 3.3.1 (Jul 2020); http://hmmer.org/
# Copyright (C) 2020 Howard Hughes Medical Institute.
# Freely distributed under the BSD open source license.
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -
# query HMM file:                  ../tmp/path.carbon/TIGR00419.hmm
# target sequence database:        /tmp/gapView.4577.genome.faa
# - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - - -

Query:       TIGR00419  [M=228]
Accession:   TIGR00419
Description: tim: triose-phosphate isomerase
Scores for complete sequences (score includes all domains):
   --- full sequence ---   --- best 1 domain ---    -#dom-
    E-value  score  bias    E-value  score  bias    exp  N  Sequence                       Description
    ------- ------ -----    ------- ------ -----   ---- --  --------                       -----------
    4.8e-50  156.5   0.0    5.5e-50  156.3   0.0    1.0  1  lcl|MicrobesOnline__882:207136  DVU1677 triosephosphate isomeras


Domain annotation for each sequence (and alignments):
>> lcl|MicrobesOnline__882:207136  DVU1677 triosephosphate isomerase
   #    score  bias  c-Evalue  i-Evalue hmmfrom  hmm to    alifrom  ali to    envfrom  env to     acc
 ---   ------ ----- --------- --------- ------- -------    ------- -------    ------- -------    ----
   1 !  156.3   0.0   5.5e-50   5.5e-50       1     227 [.       4     242 ..       4     243 .. 0.91

  Alignments for each domain:
  == domain 1  score: 156.3 bits;  conditional E-value: 5.5e-50
                       TIGR00419   1 lviinfKlnesvgkvelevaklaeevas..eagvevavappfvdldvvkdeve..seiqvaAqnvdavksGaftGeisA 75 
                                     l+  n+K+  ++ +      +l   va+  +a+ ev v ppf  l+ ++d  +      ++ q+v   + Ga+tGei  
  lcl|MicrobesOnline__882:207136   4 LIAANWKMYKTIDEARATGRELVSAVAGslPADREVLVCPPFTALHALHDTFKdvEGFAIGGQDVYPATEGAYTGEIAP 82 
                                     6889***988999988888888888887335899***************998854578999****************** PP

                       TIGR00419  76 emlkdlGakgvligHsErRsllkeadeliekkvarlkelglksvvCvgetleereaartinnvattaaa.aA....... 146
                                      ml d+G+ +vl gHsErR +l e de ++ k a   + gl++v+C+ge l+erea+r  +++a++ ++  A       
  lcl|MicrobesOnline__882:207136  83 GMLLDAGCGWVLTGHSERRHILGEDDETVARKTAFSLKAGLRVVLCIGEKLDEREAGRLEDVLAHQLQVgLAdvdatyv 161
                                     *********************************************************9999998886652346777755 PP

                       TIGR00419 147 lepdvvAvEPveliGtGkpvskAeaevveksvrdhlkkvskevaesvrvlyGasvtaaedaelaaqldvdGvLlasavl 225
                                      ++ vvA+EPv++iGtGk++ +Ae  + ++ vr  l+         +r+lyG+sv+  ++ael    +vdG+L+++a+l
  lcl|MicrobesOnline__882:207136 162 PQSLVVAYEPVWAIGTGKVAGPAEVVEAHALVRSLLEARYGRDGAAIRILYGGSVKPDNAAELLSLDNVDGLLVGGASL 240
                                     56779****************************9999988888999******************999***********9 PP

                       TIGR00419 226 ka 227
                                     +a
  lcl|MicrobesOnline__882:207136 241 QA 242
                                     87 PP



Internal pipeline statistics summary:
-------------------------------------
Query model(s):                            1  (228 nodes)
Target sequences:                          1  (251 residues searched)
Passed MSV filter:                         1  (1); expected 0.0 (0.02)
Passed bias filter:                        1  (1); expected 0.0 (0.02)
Passed Vit filter:                         1  (1); expected 0.0 (0.001)
Passed Fwd filter:                         1  (1); expected 0.0 (1e-05)
Initial search space (Z):                  1  [actual number of targets]
Domain search space  (domZ):               1  [number of targets reported over threshold]
# CPU time: 0.00u 0.00s 00:00:00.00 Elapsed: 00:00:00.00
# Mc/sec: 6.53
//
[ok]

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory