GapMind for catabolism of small carbon sources

 

Aligments for a candidate for aacS in Desulfovibrio vulgaris Hildenborough

Align Acetoacetate--CoA ligase (EC 6.2.1.16) (characterized)
to candidate 206897 DVU1453 long-chain-fatty-acid--CoA ligase

Query= reanno::acidovorax_3H11:Ac3H11_3009
         (578 letters)



>lcl|MicrobesOnline__882:206897 DVU1453 long-chain-fatty-acid--CoA
           ligase
          Length = 564

 Score =  224 bits (571), Expect = 7e-63
 Identities = 161/562 (28%), Positives = 272/562 (48%), Gaps = 55/562 (9%)

Query: 33  AFFADMVARQPEREALVSVHQGRRYTYAQLQTEAHRLASALLGMGLTPGDRVGIWSHNNA 92
           AF  +   R P++ A++   +  + +YA+L+  A R A+ L   G+ PGDRV +   N  
Sbjct: 24  AFLDEAAERHPKQTAII--FRNYKVSYAKLRLLAERFAANLRAQGVLPGDRVSVMLPNVP 81

Query: 93  EWVLMQLATAQVGLVLVNINPAYRTAEVEYALNKVGCKLLVSM----------------A 136
           + ++      + G  +V  NP Y   E+ + ++  G + ++++                 
Sbjct: 82  QAIIAFWGLLKAGCTVVMTNPLYMEKELVHQIHDSGAEYMIALDLVWPKIEPLRDRLGIR 141

Query: 137 RF---KTSDYLGMLRELAPEWQGQQPGHLQAAKLPQLKTVVWIDDEAGQGADEPGLLRFT 193
           +F   + SD LG    L   ++ ++ G  +         + W             L +  
Sbjct: 142 KFFITRISDALGFPLNLLYRFKAKREGTWRDVPFDGETVIPW-----------KTLFKKK 190

Query: 194 ELIARGNAADPRLAQVAAGLQATDPINIQFTSGTTGFPKGATLTHRNILNN----GFFIG 249
           E    G +A     + A  L       +Q+T GTTG  KG  LTH N+  N       +G
Sbjct: 191 E----GYSAKVENPREALAL-------LQYTGGTTGISKGVMLTHYNLSVNVQQIKAILG 239

Query: 250 ECMKLTPADRLCIPVPLYHCFGMVLGNLACFTHGATIVYPNDGFDPLTVLQTVQDERCTG 309
           E  ++         +P +H +G+          GATI+ P   + P  VL  +   + T 
Sbjct: 240 ESTRMRHT--FLGLMPYFHVYGLTTCLTLPTALGATII-PFPRYVPRDVLVGIDKHKPTI 296

Query: 310 LHGVPTMFIAELDHPRFAEFNLSTLRTGIMAGSPCPTEVMKRVVEQMNLREITIAYGMTE 369
             G P+++I+ +      EF+L +++  I   +P P E ++R  E    + I   +G+TE
Sbjct: 297 FPGAPSIYISLMQQKDVGEFDLKSIKYCISGSAPMPLEHIRRFHELTGAQVIE-GFGLTE 355

Query: 370 TSPVSCQSSTDTPLSKRVSTVGQVQPHLEVKIVDPDTGAV-VPIGQRGEFCTKGYSVMHG 428
            SPV+  +       ++  ++G   P  E ++VD + G V +P G+ GE   +G  VM G
Sbjct: 356 ASPVTHLNPIHGV--QKPGSIGVPFPDTEARVVDMEVGLVPLPPGKIGELIIRGPQVMQG 413

Query: 429 YWGDEAKTREAIDEGGWMHTGDLATMDAEGYVNIVGRIKDMVIRGGENIYPREIEEFLYR 488
           Y     +T   +   GW++TGD+ATMD +GY  IV R KDM+I GG N+YPREI+E L+ 
Sbjct: 414 YLNRPDETANTL-RNGWLYTGDIATMDEDGYFFIVDRKKDMIIVGGYNVYPREIDEVLHE 472

Query: 489 HPQVQDVQVVGVPDQKYGEELCAWIIAKPGTQPTEDDIRAFCKGQIAHYKVPRYIRFVTS 548
           HP+V++   VGVP    GE + A+I+ + G + T+ +I A C+ Q+A+YKVP+ + F   
Sbjct: 473 HPKVKEAVTVGVPHATRGEIIKAYIVPREGVKLTKAEIVAHCREQLANYKVPKQVEFRNE 532

Query: 549 FPMTVTGKIQKFKIRDEMKDQL 570
            P T+ GK+ +  +R E +++L
Sbjct: 533 LPKTIVGKVLRRILRAEEEERL 554


Lambda     K      H
   0.320    0.136    0.412 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 797
Number of extensions: 52
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 2
Length of query: 578
Length of database: 564
Length adjustment: 36
Effective length of query: 542
Effective length of database: 528
Effective search space:   286176
Effective search space used:   286176
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory