Align NatA, component of The neutral amino acid permease, N-1 (transports pro, phe, leu, gly, ala, ser, gln and his, but gln and his are not transported via NatB) (characterized)
to candidate 209489 DVU0550 high-affinity branched-chain amino acid ABC transporter, ATP binding protein
Query= TCDB::Q7A2H0 (260 letters) >MicrobesOnline__882:209489 Length = 262 Score = 180 bits (456), Expect = 3e-50 Identities = 97/255 (38%), Positives = 156/255 (61%), Gaps = 5/255 (1%) Query: 11 LLAASGLCKSFGGIKAVQEARIEVAQGSITGLIGPNGAGKTTLFNLLSNFIRPDKGRVIF 70 +L + K+FGG++A+ E + V G I LIGPNGAGKTT FN ++ P +G V+ Sbjct: 4 VLDVRSISKNFGGLRALNEVDLRVDAGEIVALIGPNGAGKTTFFNCITGIYVPTEGEVVV 63 Query: 71 D---GEPIQQ--LQPHQIAQQGMVRTFQVARTLSRLSVLENMLLAAQKQTGENFWQVQLQ 125 EP++ +P+Q+ + GM RTFQ R ++VLEN+++ +T L+ Sbjct: 64 TRPGSEPVRVNGQKPNQVTELGMARTFQNIRLFQNMTVLENVMIGCHCRTRSGILGALLR 123 Query: 126 PQVVVKEEKQLQEQAMFLLESVGLAKKAYEYAGGLSGGQRKLLEMGRALMTNPKLILLDE 185 EE+++ +++ LL+SV L + E A L G ++ LE+ RAL TNP L+LLDE Sbjct: 124 DAKTRGEEQEIIDKSYELLKSVHLQQHYKEQARNLPYGAQRRLEIARALATNPFLLLLDE 183 Query: 186 PAAGVNPRLIDDICDRILTWNRQDGMTFLIIEHNMDVIMSLCDRVWVLAEGQNLADGTPA 245 PAAG+NP+ ++ +L + ++ L+IEH+M+++MSL DR++V+ G +A+GTP Sbjct: 184 PAAGMNPQETLELKGLVLEIRERLNLSVLLIEHDMNMVMSLSDRIYVMEYGSKIAEGTPE 243 Query: 246 EIQTNSQVLEAYLGK 260 E+ N +V++AYLG+ Sbjct: 244 EVSRNPRVIKAYLGE 258 Lambda K H 0.319 0.136 0.391 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 170 Number of extensions: 6 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 262 Length adjustment: 25 Effective length of query: 235 Effective length of database: 237 Effective search space: 55695 Effective search space used: 55695 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory