Align ABC transporter for L-Lysine, periplasmic substrate-binding component (characterized)
to candidate 209037 DVU0107 glutamine ABC transporter, periplasmic glutamine-binding protein
Query= reanno::pseudo5_N2C3_1:AO356_05495 (260 letters) >MicrobesOnline__882:209037 Length = 249 Score = 100 bits (249), Expect = 3e-26 Identities = 74/242 (30%), Positives = 112/242 (46%), Gaps = 7/242 (2%) Query: 11 LALCMAAGVATAKEYKELRFGVDPSYAPFESKAADGSLVGFDIDLGNAICAELKVKCKWV 70 L L + G+A K+L D ++ PFE K DG GFDI+L AI V K Sbjct: 9 LGLALVLGLAATASAKQLVVAHDTNFKPFEFKGEDGKYTGFDIELWQAIAKIAGVDYKLQ 68 Query: 71 ESDFDGMIPGLKANKFDGVISSMTVTPAREKVIDFSSELFSGPTAYVFKKGSGLSEDVAS 130 DF+G+IPGL+ D I+ +T+ P R V+DFS + + ++ + V Sbjct: 69 PMDFNGIIPGLQTGNVDVGIAGITIKPERAAVVDFSDPYYDSGLMILVRENETGIKAVED 128 Query: 131 LKGKTIGYEQGTIQEAYAKAVLDKAGVKTQAYQNQDQVYADLTSGRLDAAIQDMLQAELG 190 L GK + + T + K+ KA + + + N D ++ +L +G DA I DM + Sbjct: 129 LAGKIVAVKTATSSVDFMKS-FGKA-KELKLFPNNDSMFFELMAGGADAVIFDMPVVKEF 186 Query: 191 FLKSPKGEGYEVSKPVDSELLPAKTAIGIKKGNSELKALLDKGIKALHDDGKYAEIQKKH 250 + + KG+ K V IG KG SEL ++ +K L DG Y ++ K Sbjct: 187 AMTAGKGK----VKVVGPLYQGQSYGIGFPKG-SELVGKVNDALKQLKADGSYDKLFVKW 241 Query: 251 FG 252 FG Sbjct: 242 FG 243 Lambda K H 0.314 0.133 0.370 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 187 Number of extensions: 9 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 249 Length adjustment: 24 Effective length of query: 236 Effective length of database: 225 Effective search space: 53100 Effective search space used: 53100 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.2 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 42 (21.9 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory