Align Amino-acid ABC transporter, ATP-binding protein (characterized, see rationale)
to candidate 206675 DVU1236 amino acid ABC transporter, ATP-binding protein
Query= uniprot:Q88GX0 (260 letters) >MicrobesOnline__882:206675 Length = 247 Score = 277 bits (709), Expect = 1e-79 Identities = 144/251 (57%), Positives = 178/251 (70%), Gaps = 5/251 (1%) Query: 9 TLAPEPDPRPVLIRIEGLNKHYGAFHVLRDIDLQVREGERIVLCGPSGSGKSTLIRCINR 68 T A EP +I I + K +G L D+ L V+ GE++V+ GPSGSGKSTL+R INR Sbjct: 2 TAANEP-----IISIRNVWKFFGELTALHDVSLDVQAGEKVVIIGPSGSGKSTLLRSINR 56 Query: 69 LEVAQQGSIQVDGIDLAATTREAAQVRSDIGMVFQHFNLFPHMSVLDNCLLAPTSVRGLS 128 LE +GSI VDG D+ A + +R D+GMVFQ FNLFPH +VL N +AP +R + Sbjct: 57 LENVDKGSIIVDGKDIRAEDSDINVIRQDLGMVFQSFNLFPHKTVLQNLTMAPMRLRKVP 116 Query: 129 RKDAEERARMYLSKVGIESQAHKYPSQLSGGQQQRVAIARALCMKPRIMLFDEPTSALDP 188 R +AE RA L KVGI +A+ YP+ LSGGQQQRVAIARAL M P+IMLFDEPTSALDP Sbjct: 117 RDEAESRALDLLKKVGISDKANVYPAMLSGGQQQRVAIARALAMNPKIMLFDEPTSALDP 176 Query: 189 EMVAEVLDVLVQLAGTGMTMLCVTHEMGFARQVAERVLFLEGGQIIEDSPPQVFFNQPRT 248 EM+ EVLDV+V LA GMTM+CVTHEMGFAR+VA+R++F++ GQI+E PQ FF P Sbjct: 177 EMIGEVLDVMVTLAKEGMTMVCVTHEMGFAREVADRIIFMDHGQILEQGTPQHFFEAPEH 236 Query: 249 ERAKAFLAQIL 259 R + FL QIL Sbjct: 237 PRLQKFLQQIL 247 Lambda K H 0.322 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 191 Number of extensions: 2 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 260 Length of database: 247 Length adjustment: 24 Effective length of query: 236 Effective length of database: 223 Effective search space: 52628 Effective search space used: 52628 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory