Align Probable permease of ABC transporter, component of Amino acid transporter, PA5152-PA5155. Probably transports numerous amino acids including lysine, arginine, histidine, D-alanine and D-valine (Johnson et al. 2008). Regulated by ArgR (characterized)
to candidate 209323 DVU0387 amino acid ABC transporter, permease protein, His/Glu/Gln/Arg/opine family
Query= TCDB::Q9HU30 (231 letters) >MicrobesOnline__882:209323 Length = 225 Score = 133 bits (334), Expect = 3e-36 Identities = 75/210 (35%), Positives = 118/210 (56%), Gaps = 10/210 (4%) Query: 12 LLAGTWMTLKLSLAAVCVGLLLGLLGAIAKTSKYAALRFLGGTYTTIVRGVPETLWVLMI 71 +L G+ +T+ L ++ +G +G+ A+A+ +R+L G Y RG+P + + + Sbjct: 15 ILEGSAVTIATVLGSLALGFCMGVPMAVAQVYGGRPVRYLVGLYVWFFRGMPILVLLFLF 74 Query: 72 YFGTVSGLNALGDLFGKPDLALSPFAAGTLALGLCFGAYATEVFRGALLSIPRGHREAGQ 131 YFG LF DL LS F A L LG+ AY +++FRG++L++P+G +A + Sbjct: 75 YFG----------LFQALDLNLSAFTASCLVLGMASAAYQSQIFRGSILALPQGQLKAAR 124 Query: 132 ALGLSPGRIFWRIVLPQIWRVALPGLGNLYLILLKDTALVSLITLDEIMRKAQVASNATK 191 ALG+S G IVLPQ R+++P N Y ILLKD+AL ++ EIM + ++ T Sbjct: 125 ALGMSDGAAIRSIVLPQALRLSIPAWSNEYSILLKDSALAFVLGTPEIMARTHFVASRTY 184 Query: 192 EPFTFYMTAAAIYLSLTVVIMVALHFLERR 221 E YMTA A+Y +T+ + L LER+ Sbjct: 185 EHLPLYMTAGALYFIITLAGLKVLRHLERK 214 Lambda K H 0.327 0.143 0.431 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 123 Number of extensions: 7 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 231 Length of database: 225 Length adjustment: 23 Effective length of query: 208 Effective length of database: 202 Effective search space: 42016 Effective search space used: 42016 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 15 ( 7.1 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.7 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory