Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate 207835 DVU2347 acetylornithine aminotransferase
Query= BRENDA::P42588 (459 letters) >MicrobesOnline__882:207835 Length = 399 Score = 198 bits (504), Expect = 2e-55 Identities = 126/366 (34%), Positives = 197/366 (53%), Gaps = 32/366 (8%) Query: 78 DTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAK-----QPLHSQELLDPLRAMLAKT 132 D +G+E+ID L G + ++GH +P + + Q K + +E LD + K Sbjct: 37 DHEGREYIDLLSGIAVTSLGHCHPELAEVMARQARKLVHVSNLFYQEEQLD----LAEKL 92 Query: 133 LAALTPGKLKYSFFCNSGTESVEAALKLAKAY-QSPRG--KFTFIATSGAFHGKSLGALS 189 L+ L K +FFCNSG E+ EAA+KLA+ Y Q RG + +GAFHG++L ++ Sbjct: 93 LSTLHCTK---AFFCNSGAEANEAAIKLARRYMQRVRGVDAHEVVTLTGAFHGRTLATVA 149 Query: 190 ATAKSTFRKPFMPLLPGFRHVPFGNIEAMRTALNECKKTGDDVAAVILEPIQGEGGVILP 249 AT + F+ F P+ GFR +G+I+A+R A+ A V++E +QGEGGV Sbjct: 150 ATGQERFQDGFAPMPAGFRQAEWGDIDALRAAITPA------TAGVLVEMVQGEGGVRPM 203 Query: 250 PPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFACEHENVQPDILCLAKALGGGVMPI 309 Y AV LC E G L+++DE+QTG+ RTG+ +A +H V+PDI+ AKAL G +P+ Sbjct: 204 TQDYARAVADLCREKGVLLMVDEIQTGLCRTGRFWAHQHYGVEPDIVTSAKALANG-LPM 262 Query: 310 GATIATEEVFSVLFDNPFLHTTTFGGNPLACAAALATINVLLEQNLPAQAEQKGDMLLDG 369 GA + T+EV H TTFG L + A AT++++ L +A G ++ Sbjct: 263 GAMMTTDEVAQGFVAGS--HATTFGAGALVSSVAAATLDIMKRDRLDERATAVGGRAMER 320 Query: 370 FRQLAREYPDLVQEARGKGMLMAIEFVDNEIGYNFASEMFRQRVLVAGTLNNA--KTIRI 427 FR + + P ++E RG G+++ I + E++++ V NN K +R+ Sbjct: 321 FRAIGAKLPGTIEEVRGYGLMIGIVLTFS------GKEVWKELVARGFVCNNTQEKVLRL 374 Query: 428 EPPLTL 433 P LT+ Sbjct: 375 VPALTI 380 Lambda K H 0.320 0.135 0.393 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 382 Number of extensions: 20 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 459 Length of database: 399 Length adjustment: 32 Effective length of query: 427 Effective length of database: 367 Effective search space: 156709 Effective search space used: 156709 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory