GapMind for catabolism of small carbon sources

 

Aligments for a candidate for patA in Desulfovibrio vulgaris Hildenborough

Align putrescine-2-oxoglutarate transaminase (EC 2.6.1.82) (characterized)
to candidate 208056 DVU2559 adenosylmethionine--8-amino-7-oxononanoate aminotransferase

Query= BRENDA::P42588
         (459 letters)



>lcl|MicrobesOnline__882:208056 DVU2559
           adenosylmethionine--8-amino-7-oxononanoate
           aminotransferase
          Length = 542

 Score =  179 bits (455), Expect = 2e-49
 Identities = 133/422 (31%), Positives = 205/422 (48%), Gaps = 54/422 (12%)

Query: 74  NTLVDTQGQEFIDCLGGFGIFNVGHRNPVVVSAVQNQLAKQPLHSQELLDPLRAM-LAKT 132
           N L+DT G  ++D +        GHR+P +  A++ QL +    +   L    ++ LA  
Sbjct: 93  NHLIDTDGNRYLDGVSSLWTNVHGHRHPHIDEAIRRQLDRVAHSTLLGLGGTPSIELAAR 152

Query: 133 LAALTPGKLKYSFFCNSGTESVEAALKLAKAY--QSPRG---KFTFIATSGAFHGKSLGA 187
           L A+ P  L   F+ +SG+ +VEAALK+A  Y  Q+P G   +   +A S A+HG ++G+
Sbjct: 153 LTAIAPAGLTRVFYSDSGSTAVEAALKIAFQYHRQAPEGDARRTRVMAFSNAYHGDTIGS 212

Query: 188 LSATAKSTFRKPFMPLL--------PGFRHVP------------FGNIEAMRTALNECKK 227
           +S    S F   + PLL        P     P             G +E +       + 
Sbjct: 213 VSLGGMSLFHGIYGPLLFDPVRAPAPHCYRCPADLRPETCGMACLGEVERLM------RH 266

Query: 228 TGDDVAAVILEP-IQGEGGVILPPPGYLTAVRKLCDEFGALMILDEVQTGMGRTGKMFAC 286
            G ++ AV++EP +QG  G+++ P G+L  +R LCD  G  M+ DEV  G G+TG MFAC
Sbjct: 267 HGHELCAVVVEPLVQGAAGMLVQPRGWLRGLRDLCDRHGVFMVADEVAVGFGKTGTMFAC 326

Query: 287 EHENVQPDILCLAKALGGGVMPIGATIATEEVFSVLFD-----NPFLHTTTFGGNPLACA 341
           E E V PD+LCLAK + GG +P+ AT+ TE +             F H  T+ GN LACA
Sbjct: 327 EQEGVVPDMLCLAKGITGGYLPLAATLVTEHIHDGFLGGYADFRTFFHGHTYTGNALACA 386

Query: 342 AALATINVLLEQNLPAQAEQKGDMLLDGFRQLAREYPDLVQEARGKGMLMAIEFV----- 396
           AALA+++V  E+        + + L      L  + P  V + R  G++  IE V     
Sbjct: 387 AALASLDVFEEERTLETLRPRIERLATLLAPL-NDLPH-VGDIRRVGVMTGIELVADRET 444

Query: 397 ------DNEIGYNFASEMFRQRVLVAGTLNNAKTIRIEPPLTLTIEQCELVIKAARKALA 450
                 +  IG+    E  R+ V+V         + + PPL++T  + E ++   R A+ 
Sbjct: 445 RTPYRPEERIGHRVTLEARRRGVIVRPL---GDVMVLMPPLSITETELETLVHTVRGAII 501

Query: 451 AM 452
           A+
Sbjct: 502 AV 503


Lambda     K      H
   0.320    0.135    0.393 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 534
Number of extensions: 25
Number of successful extensions: 5
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 459
Length of database: 542
Length adjustment: 34
Effective length of query: 425
Effective length of database: 508
Effective search space:   215900
Effective search space used:   215900
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 52 (24.6 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory