Align D-2-hydroxyglutarate--pyruvate transhydrogenase DLD2; D-2HG--pyruvate transhydrogenase DLD2; Actin-interacting protein 2; D-lactate dehydrogenase [cytochrome] 2, mitochondrial; D-lactate ferricytochrome C oxidoreductase; D-LCR; EC 1.1.99.40; EC 1.1.2.4 (characterized)
to candidate 208541 DVU3027 glycolate oxidase, subunit GlcD
Query= SwissProt::P46681 (530 letters) >MicrobesOnline__882:208541 Length = 461 Score = 167 bits (424), Expect = 6e-46 Identities = 136/439 (30%), Positives = 211/439 (48%), Gaps = 34/439 (7%) Query: 104 LVLRPKSVEKVSLILNYCNDEKIAVVPQGGNTGLVGGSVPIFDELILSLAN-LNKIRDFD 162 LVLRP E++ ++ C + + +G T L GG++P E I+ L N LNKI + + Sbjct: 43 LVLRPTETEQLGKLVKLCYENDHPITVRGAGTNLSGGTIPDKREGIVILTNSLNKIIEIN 102 Query: 163 PVSGILKCDAGVILENANNYVMEQNYMFPLDLGAKGSCHVGGVVATNAGGLRLLRYGSLH 222 + GV+ V ++ +P D G++ +GG VA NAGGLR L+YG Sbjct: 103 EQDLYAVVEPGVVTAKFAAEVAKRGLFYPPDPGSQAVSTLGGNVAENAGGLRGLKYGVTK 162 Query: 223 GSVLGLEVVMPNGQIVNSMHSMRKDNTGYDLKQLFIGSEGTIGIITGVSILTVPKPKAFN 282 V+G+E NG +V + K TGY+L L SEGT+G+ + +++ VP PKA Sbjct: 163 DYVMGIEFFDVNGGLVKTGSRTVKCVTGYNLAGLMAASEGTLGVFSQITLKLVPPPKA-- 220 Query: 283 VSYLSVESFEDVQKVFVRARQELSEILSA------FEFMDAKSQVLAKSQLKDAAFPLED 336 S + F+DV K A + ++ I++A EFMD KS + A P Sbjct: 221 -SKAMMAVFDDVNK----ASEAVAAIIAAHVVPCTLEFMD-KSSINYVEDFTKAGLP--R 272 Query: 337 EHPFYILIETSGSNKDHDDSKLETFLENVMEEGIVTDGVVAQDETELQNLWK-WREMIPE 395 E +LIE G +D T ++ + G T+ VA+D E LW+ R +P Sbjct: 273 EAAAILLIEVDGHPAQVEDD-AATVVKALNASG-ATEVHVAKDAAEKFKLWEARRNALPA 330 Query: 396 ASQANGGVYKYDVSLPLKDLYSLVEATNARLSEAELVGDSPKPVVGAIG-YGHVGDGNLH 454 ++A D ++P + ++V+A N D K AIG +GH GDGNLH Sbjct: 331 LARARATTVLEDATVPRSQIPAMVKAIN----------DIAKKHNIAIGTFGHAGDGNLH 380 Query: 455 LNVAVREYNKNIEKTLEPFV---YEFVSSKHGSVSAEHGLGFQKKNYIGYSKSPEEVKMM 511 + +K+ + +E V ++ S HG++S EHG+G K ++ S ++ Sbjct: 381 PTILCDRRDKHEFERVESAVDEIFDVALSLHGTLSGEHGIGLAKSKWMEKETSKATIEYS 440 Query: 512 KDLKVHYDPNGILNPYKYI 530 +++K DP ILNP K I Sbjct: 441 RNMKRAIDPKYILNPGKII 459 Lambda K H 0.316 0.135 0.385 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 495 Number of extensions: 16 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 530 Length of database: 461 Length adjustment: 34 Effective length of query: 496 Effective length of database: 427 Effective search space: 211792 Effective search space used: 211792 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 52 (24.6 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory