Align Maltose/maltodextrin import ATP-binding protein MalK; EC 7.5.2.1 (characterized)
to candidate 209225 DVU0291 ABC transporter, ATP-binding protein
Query= SwissProt::P19566 (369 letters) >MicrobesOnline__882:209225 Length = 354 Score = 174 bits (441), Expect = 3e-48 Identities = 111/308 (36%), Positives = 162/308 (52%), Gaps = 24/308 (7%) Query: 18 VSKDINLDIHDGEFVVFVGPSGCGKSTLLRMIAGLETITSGDLFIGETRMNDIPPAERGV 77 V D+NL GE V VGPSG GK+TLLR IAGL+ G + + PP G Sbjct: 17 VLHDVNLTAAAGEVVCLVGPSGVGKTTLLRCIAGLDAPDEGTIRV-------TPPQGHGG 69 Query: 78 G--MVFQSYALYPHLSVAENMSFGLKLAGAKKEVMNQRVNQVAEVLQL-----AHLLERK 130 G +VFQ Y L+PHLSV EN++FG + G + + +RV+ + +L AH+ R Sbjct: 70 GVVLVFQDYLLFPHLSVFENVAFGPRARGVRGAALKERVHTMLRAFRLDTDDLAHMASRY 129 Query: 131 PKALSGGQRQRVAIGRTLVAEPRVFLLDEPLSNLDAALRVQMRIEISRLHKRLGRTMIYV 190 P LS GQRQRVA+ R LV +P V LLDEP +NLD LR +M + + +R G + V Sbjct: 130 PAQLSAGQRQRVALARALVCDPAVLLLDEPFANLDRGLRGEMAAFVRDVVRRFGVATVTV 189 Query: 191 THDQVEAMTLADKIVVLDAGRVAQVGKPLELYHYPADRFVAGFIGSPKMNFLPVKV-TAT 249 THD EA + D++ V+ G +AQ+ PL++Y +PAD A F+G PV V T Sbjct: 190 THDLEEAFAIGDRLGVMLGGTLAQLAPPLDVYRHPADEATARFLG-------PVTVLDET 242 Query: 250 AIEQVQVELPNRQQIWLPVESRGVQVGANMSLGIRPEHLLPSDIADVTLEGEVQ--VVEQ 307 + ++ P +G+++ +L +RP P+ + G+V +++ Sbjct: 243 TRRTLGIDTPPAAATACADTMQGLRLYRPEALAVRPWADGPAVLVSARFTGQVMQLLLDV 302 Query: 308 LGHETQIH 315 G E +H Sbjct: 303 EGQELLVH 310 Lambda K H 0.321 0.138 0.396 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 317 Number of extensions: 14 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 369 Length of database: 354 Length adjustment: 29 Effective length of query: 340 Effective length of database: 325 Effective search space: 110500 Effective search space used: 110500 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory