Align ABC transporter for D-Maltose and D-Trehalose, ATPase component (characterized)
to candidate 209035 DVU0105 glutamine ABC transporter, ATP-binding protein
Query= reanno::Smeli:SMc03065 (362 letters) >MicrobesOnline__882:209035 Length = 244 Score = 162 bits (411), Expect = 7e-45 Identities = 94/236 (39%), Positives = 136/236 (57%), Gaps = 7/236 (2%) Query: 6 LKDIRKSYGAVDVIHGIDLDIKEGEFVVFVGPSGCGKSTLLRMIAGLEEITGGDMFIDG- 64 ++++ KSYG V+ GIDL ++ GE VV +GPSG GKST LR I LEEIT G + +DG Sbjct: 7 IRNLHKSYGDHHVLRGIDLTVRTGEVVVVIGPSGSGKSTALRCINRLEEITSGTIIVDGY 66 Query: 65 ---ERVNDVPPSKRGIAMVFQSYALYPHMTVYDNMAFG-MRIARESKEEIDRRVRGAADM 120 + D+ + MVFQ + L+PHM+V +N+ G +++ R +++E + Sbjct: 67 DLYDPKTDINHVRTEAGMVFQQFNLFPHMSVLENVTIGPVKVRRMARQEAQALGLALLEK 126 Query: 121 LQLTPYLDRLPKALSGGQRQRVAIGRAICRNPKVFLFDEPLSNLDAALRVATRIEIAKLS 180 + L P LSGGQ+QRVAI R++ PKV LFDEP S LD L V +E+ K Sbjct: 127 VGLADKAHAYPDQLSGGQKQRVAIARSLAMQPKVLLFDEPTSALDPEL-VGEVLEVMKQL 185 Query: 181 ERMSDTTMIYVTHDQVEAMTLADRIVVLSAGHIEQVGAPLELYERPANLFVARFIG 236 R TM+ VTH+ A +ADR++ + G I++ G P EL+ P N + F+G Sbjct: 186 AR-EGMTMVVVTHEMGFAREVADRVIFIDYGKIQEEGPPNELFADPKNPRLREFLG 240 Lambda K H 0.320 0.137 0.387 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 220 Number of extensions: 11 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 362 Length of database: 244 Length adjustment: 26 Effective length of query: 336 Effective length of database: 218 Effective search space: 73248 Effective search space used: 73248 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory