Align TM1749, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate 209099 DVU0166 oligopeptide/dipeptide ABC transporter, ATP-binding protein
Query= TCDB::Q9X271 (324 letters) >MicrobesOnline__882:209099 Length = 328 Score = 278 bits (712), Expect = 1e-79 Identities = 152/327 (46%), Positives = 207/327 (63%), Gaps = 8/327 (2%) Query: 1 MMELLNVNNLKVEFHRVEGIVKAVDGISYKLNKGESLGIVGESGSGKSVSVLSLLRLINR 60 M LL+V NL V+F + + AV+ +S+ L +GE LG+VGESG+GKSV+ S++ LI++ Sbjct: 1 MEALLDVQNLTVKFALRDEALTAVNDVSFTLGRGERLGLVGESGAGKSVTGFSIINLISK 60 Query: 61 NGRIVDGEAIFLGKDLLKLNKEELRNIRGKDISIIFQNPMTSLNPIIRVGIQVMEPIIWH 120 G I G +F G DL+ + E LR+IRG IS+IFQ+PM +LNP++ +G Q++E I+ H Sbjct: 61 PGFIAGGSVLFEGNDLVTTDAETLRDIRGNRISMIFQDPMMTLNPVLTIGSQMVETILAH 120 Query: 121 RLMKNEEARERAIELLERVGIPESPKRFLNYPFQFSGGMRQRVMIAMALACHPKLLIADE 180 + M EA E A++ L +V IP KR YP +FSGGMRQR++IA+AL P L+IADE Sbjct: 121 QKMSRREAEEIALDKLRKVYIPSPEKRLKQYPHEFSGGMRQRIVIAIALLTSPSLIIADE 180 Query: 181 PTTALDVTIQAQIMELLQELKEEYGMSVIFITHDLSVATNFCDRIITMYAGKIVEEAPVE 240 PTTALDVTIQA+IM+LL EL E M +I ITHDL V + +I MYAG+IVE Sbjct: 181 PTTALDVTIQAEIMDLLLELCESEKMGLILITHDLGVVSQVTQKIAVMYAGRIVEMGETA 240 Query: 241 EILKTPLHPYTKGLLNSTLEIGSRG-------KKLVPIPGNPPNPTKHPSG-CKFHPRCS 292 I+ P HPYTKGLL + + S G +L IPG P+ ++ G C FH RC Sbjct: 241 RIVADPQHPYTKGLLAALPQGNSCGGGCVGKRHRLNQIPGAMPSLSEIAHGICPFHNRCE 300 Query: 293 FAMEICQREEPPLVNISENHRVACHLI 319 ++C+ P L+ VACHL+ Sbjct: 301 LCQDVCRTSRPRLLPKRNGGLVACHLL 327 Lambda K H 0.320 0.139 0.401 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 257 Number of extensions: 13 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 324 Length of database: 328 Length adjustment: 28 Effective length of query: 296 Effective length of database: 300 Effective search space: 88800 Effective search space used: 88800 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 48 (23.1 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory