Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate 209098 DVU0165 oligopeptide/dipeptide ABC transporter, ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >MicrobesOnline__882:209098 Length = 337 Score = 294 bits (752), Expect = 2e-84 Identities = 152/338 (44%), Positives = 219/338 (64%), Gaps = 20/338 (5%) Query: 8 IKMKPLLQTVDLKKYFP-----------------QGKRILKAVDGISIEIKEGETLGLVG 50 ++ KPLL ++ K+F + + ++ AV+ +S I EGETL +VG Sbjct: 1 MQQKPLLNLRNVVKHFDISGGFLDQLRLTGSGIVRKRTVVHAVNDVSFTINEGETLSVVG 60 Query: 51 ESGCGKSTLGRTILKLLRPDGGKIFFEGKDITNLNDKEMKPYRKKMQIIFQDPLGSLNPQ 110 ESGCGKSTL RT++ L RP+ G+I + + I +L+D EM PYR +MQ++FQDP SLNP+ Sbjct: 61 ESGCGKSTLARTVIGLYRPNSGEIHYRDRRIDHLSDTEMLPYRTRMQMVFQDPYASLNPR 120 Query: 111 MTVGRIIEDPLIIHKIGTKK-ERRKRVEELLDMVGIGREFINSFPHEFSGGQQQRIGIAR 169 M V +I+E+P+ H G + E RV +++ VGI + +PHEFSGGQ+QRI IAR Sbjct: 121 MRVNQILEEPIRFHNPGIGEGEVLDRVAAVMEQVGINPVWATRYPHEFSGGQRQRISIAR 180 Query: 170 ALALNPKFIVCDEPVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAV 229 ALA++P+FIV DEP+SALDVSIQAQ+++L+ ++Q++ ++YLFI+H+L+VVEHIS +VAV Sbjct: 181 ALAVDPEFIVADEPISALDVSIQAQVLNLMMDMQEQRNLTYLFISHDLSVVEHISTRVAV 240 Query: 230 MYLGKIVEYGDVDKIFLNPIHPYTRALLKSVPKIPWDGQKQRFYSLKGELPSPIDLPKGC 289 MYLG + E + +F +P HPYT+ALL ++P+I G K L G++P+PI+LP GC Sbjct: 241 MYLGSLCELATSEDLFGSPRHPYTQALLSAIPRIGQKGLKH--IRLSGDVPTPINLPSGC 298 Query: 290 RFQTRCTEKKAICFEKEPELTEVEKNHFVSCHLVRSYR 327 F RC C + P V+CH V R Sbjct: 299 VFHGRCPHADKRCMNEVPRALPQPGGALVACHAVEEGR 336 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 367 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 337 Length adjustment: 28 Effective length of query: 300 Effective length of database: 309 Effective search space: 92700 Effective search space used: 92700 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory