Align TM1750, component of Probable mannose/mannoside porter. Induced by beta-mannan (Conners et al., 2005). Regulated by mannose-responsive regulator manR (characterized)
to candidate 209099 DVU0166 oligopeptide/dipeptide ABC transporter, ATP-binding protein
Query= TCDB::Q9X272 (328 letters) >MicrobesOnline__882:209099 Length = 328 Score = 207 bits (528), Expect = 2e-58 Identities = 119/327 (36%), Positives = 186/327 (56%), Gaps = 13/327 (3%) Query: 10 MKPLLQTVDLKKYFPQGKRILKAVDGISIEIKEGETLGLVGESGCGKSTLGRTILKLLRP 69 M+ LL +L F L AV+ +S + GE LGLVGESG GKS G +I+ L+ Sbjct: 1 MEALLDVQNLTVKFALRDEALTAVNDVSFTLGRGERLGLVGESGAGKSVTGFSIINLISK 60 Query: 70 DG----GKIFFEGKDITNLNDKEMKPYR-KKMQIIFQDPLGSLNPQMTVGRIIEDPLIIH 124 G G + FEG D+ + + ++ R ++ +IFQDP+ +LNP +T+G + + ++ H Sbjct: 61 PGFIAGGSVLFEGNDLVTTDAETLRDIRGNRISMIFQDPMMTLNPVLTIGSQMVETILAH 120 Query: 125 KIGTKKERRKRVEELLDMVGIG--REFINSFPHEFSGGQQQRIGIARALALNPKFIVCDE 182 + +++E + + L V I + + +PHEFSGG +QRI IA AL +P I+ DE Sbjct: 121 QKMSRREAEEIALDKLRKVYIPSPEKRLKQYPHEFSGGMRQRIVIAIALLTSPSLIIADE 180 Query: 183 PVSALDVSIQAQIIDLLEEIQQKMGISYLFIAHNLAVVEHISHKVAVMYLGKIVEYGDVD 242 P +ALDV+IQA+I+DLL E+ + + + I H+L VV ++ K+AVMY G+IVE G+ Sbjct: 181 PTTALDVTIQAEIMDLLLELCESEKMGLILITHDLGVVSQVTQKIAVMYAGRIVEMGETA 240 Query: 243 KIFLNPIHPYTRALLKSVPK-----IPWDGQKQRFYSLKGELPSPIDLPKG-CRFQTRCT 296 +I +P HPYT+ LL ++P+ G++ R + G +PS ++ G C F RC Sbjct: 241 RIVADPQHPYTKGLLAALPQGNSCGGGCVGKRHRLNQIPGAMPSLSEIAHGICPFHNRCE 300 Query: 297 EKKAICFEKEPELTEVEKNHFVSCHLV 323 + +C P L V+CHL+ Sbjct: 301 LCQDVCRTSRPRLLPKRNGGLVACHLL 327 Lambda K H 0.321 0.142 0.417 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 284 Number of extensions: 14 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 328 Length of database: 328 Length adjustment: 28 Effective length of query: 300 Effective length of database: 300 Effective search space: 90000 Effective search space used: 90000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 49 (23.5 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory