Align Inositol transport system ATP-binding protein (characterized)
to candidate 209490 DVU0551 high-affinity branched-chain amino acid ABC transporter ATP-binding protein
Query= reanno::Phaeo:GFF717 (261 letters) >MicrobesOnline__882:209490 Length = 234 Score = 113 bits (282), Expect = 4e-30 Identities = 71/242 (29%), Positives = 123/242 (50%), Gaps = 11/242 (4%) Query: 7 LIRMQGIEKHFGSVIALAGVSVDVFPGECHCLLGDNGAGKSTFIKTMSGVHKPTKGDILF 66 ++ ++ + ++G++ AL +++ + GE L+G NGAGKST + T+ G P G++LF Sbjct: 1 MLELRNVNTYYGNIQALRDINLTIGEGEIVTLIGANGAGKSTTLMTICGATPPRTGEVLF 60 Query: 67 EGQPLHFADPRDAIAAGIATVHQHLAMIPLMSVSRNFFMGN-EPIRKIGPLKLFDHDYAN 125 EG+P+H P + + GI+ V + + P ++V N +G K G + D+ + Sbjct: 61 EGKPIHTMKPNEIVRLGISQVPEGRLIFPDLTVQENLDLGAFLRSDKEGIARDLDYIFDL 120 Query: 126 RITMEEMRKMGINLRGPDQAVGTLSGGERQTVAIARAVHFGAKVLILDEPTSALGVRQTA 185 + + R+ QA GTLSGGE+Q +AI+RA+ ++L+LDEP+ L Sbjct: 121 FPILAQRRR---------QAGGTLSGGEQQMLAISRAIMGRPRLLLLDEPSLGLAPIIIQ 171 Query: 186 NVLATIDKVRKQGVAVVFITHNVRHALAVGDRFTVLNRGK-TLGTAQRGDISAEELQDMM 244 + I K+ G V + N AL + R V+ G+ TL ++ EE++ Sbjct: 172 QIFNIIQKINGDGTTVFLVEQNANQALKIAHRGYVMETGRITLEAPAESLLTNEEVRKAY 231 Query: 245 AG 246 G Sbjct: 232 LG 233 Lambda K H 0.321 0.137 0.395 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 143 Number of extensions: 4 Number of successful extensions: 2 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 261 Length of database: 234 Length adjustment: 24 Effective length of query: 237 Effective length of database: 210 Effective search space: 49770 Effective search space used: 49770 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.9 bits) S2: 46 (22.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory