Align BadH (characterized)
to candidate 207249 DVU1784 oxidoreductase, short-chain dehydrogenase/reductase family
Query= metacyc::MONOMER-893 (255 letters) >MicrobesOnline__882:207249 Length = 253 Score = 101 bits (251), Expect = 2e-26 Identities = 73/230 (31%), Positives = 107/230 (46%), Gaps = 19/230 (8%) Query: 8 TAVITGGGGGIGGATCRRFAQEGAKIAVFDLNLDAAEKVAGAIRDAGGTAEAVRC----- 62 T ITG G G A RRFA EG ++ + + EK+A + + RC Sbjct: 4 TICITGATAGFGEACARRFAAEGCRLIITGRRKERLEKLAAELGED-------RCLPLVF 56 Query: 63 DIADRTSVDAAIATTTTTLGPVDILVNNAGWDI-FKPFTKTEPGEWERLIAINLTGALHM 121 D+ DR +V+AA A VD+L+NNAG + +P + +WE +I NL G ++ Sbjct: 57 DVRDRKAVEAAFAALPEAFANVDVLINNAGLALGLEPAHRASLEDWETMIDTNLKGLMYC 116 Query: 122 HHAVLPGMVERRHGRIVNIASDAARVGSSGEAVYAACKGGLVAFSKTLAREHARHGITVN 181 A+LPGMVER G +VN+ S A G Y A K ++ FS+ L + G+ V Sbjct: 117 TRALLPGMVERGKGHVVNLGSIAGSYPYPGGNTYGATKAFVMQFSRNLRADLHGTGVRVT 176 Query: 182 VVCPGPTDTALLADVTSGAANPEKLIEAFTKAIPLGRLGKPDDLAGAIAF 231 + PG ++ G A+ K + PL +P D+A I F Sbjct: 177 NIEPGLAESEFSVIRFKGDAS--KAAGVYKGTEPL----RPVDIADIIHF 220 Lambda K H 0.318 0.135 0.398 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 164 Number of extensions: 11 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 255 Length of database: 253 Length adjustment: 24 Effective length of query: 231 Effective length of database: 229 Effective search space: 52899 Effective search space used: 52899 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory