GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaK in Desulfovibrio vulgaris Hildenborough

Align Phenylacetate-coenzyme A ligase; Phenylacetyl-CoA ligase; PA-CoA ligase; EC 6.2.1.30 (characterized)
to candidate 207067 DVU1615 phenylacetate-coenzyme A ligase

Query= SwissProt::Q72K16
         (445 letters)



>lcl|MicrobesOnline__882:207067 DVU1615 phenylacetate-coenzyme A
           ligase
          Length = 435

 Score =  481 bits (1237), Expect = e-140
 Identities = 247/445 (55%), Positives = 311/445 (69%), Gaps = 13/445 (2%)

Query: 1   MMYQPELETLPREKLRALQEERLKRLVAYVYERVPFYRRLLDEAGVDPKGFRGLEDLPRI 60
           M++  + ETLPRE L ALQ  RL+ L   VY  VP YRR  DEAG+ P   R L DL  +
Sbjct: 1   MIFDVDRETLPREDLEALQLTRLRNLCERVYANVPHYRRRFDEAGISPADIRKLSDLKYL 60

Query: 61  PFTKKTDLRDHYPFGLFAVPREEVARVHASSGTTGKPTVVGYTKNDLKVFAEVVARSLAA 120
           PFT+K DLR++YP+GLFAVP+E + R+HASSGTTGK TVVGYTK DL  +AE++AR+ AA
Sbjct: 61  PFTEKQDLRNNYPYGLFAVPKENIVRLHASSGTTGKATVVGYTKRDLDNWAEMMARAFAA 120

Query: 121 AGARPGMMLHNAYGYGLFTGGLGLHGGAEALGMTVVPVSGGMTERQVMLIQDFRPEVISC 180
           AG     ++HNAYGYGLFTGGLG H GAE LG TV+PVSGG T+RQV L++DF   VI C
Sbjct: 121 AGVSRRDLIHNAYGYGLFTGGLGAHYGAERLGATVIPVSGGGTKRQVQLLRDFGATVICC 180

Query: 181 TPSYAQTLAEEFRKRGVSPEELSLEYAVLGAEPWTEAIRKQVDEGLGVKSTNIYGLSEII 240
           TPSYA  L E   + G+   EL L   V GAEPW+E +R ++++ LG+ + NIYGLSEI+
Sbjct: 181 TPSYALYLHEASLEAGIDMRELPLRAGVFGAEPWSEEMRAEIEQKLGISAVNIYGLSEIM 240

Query: 241 GPGVSNECVEERQGSHIWEDHFLPEVVDPDTGEPLPEGKVGVLVFTTLTKEAMPLLRYWT 300
           GPGV+ EC + + G HI+EDHFLPE++DP TGE LP G+ G LV TTLTKE +PL+RY T
Sbjct: 241 GPGVAIECADAKSGMHIFEDHFLPEIIDPVTGEQLPYGETGELVITTLTKEGIPLVRYRT 300

Query: 301 GDLTFLTYEACTCGRTHVRMGPILGRTDDMLIIRGVNVYPTQVEAVLLAIPEVVPHYQIV 360
            D+T L    C+CGRTH+RM  I GR+DDMLIIRGVNV+P Q+EA+++      PHYQIV
Sbjct: 301 RDITSLDRTPCSCGRTHMRMRRITGRSDDMLIIRGVNVFPQQIEAIIIEAEGTSPHYQIV 360

Query: 361 VRREGTLDEAELKVEVSEPFFREIGQEVLSDEVVEADHRLHALRERIARKIKDNVGVTLK 420
           V R+G LD  E+++EVS  FF        SD +     R      RI + IK+ +GVT K
Sbjct: 361 VTRDGNLDNIEVQIEVSGDFF--------SDAIKNLQRR----EARIQKTIKEFLGVTAK 408

Query: 421 VTLLPPGQAPRSEGGKLRRVLDLRK 445
           V L+ P    RSE GK +RV+DLR+
Sbjct: 409 VRLVEPRTIQRSE-GKAKRVVDLRE 432


Lambda     K      H
   0.319    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 558
Number of extensions: 15
Number of successful extensions: 2
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 445
Length of database: 435
Length adjustment: 32
Effective length of query: 413
Effective length of database: 403
Effective search space:   166439
Effective search space used:   166439
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the paper from 2022 on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory