Align Phenylacetate-coenzyme A ligase; Phenylacetyl-CoA ligase; PA-CoA ligase; EC 6.2.1.30 (characterized)
to candidate 208777 DVU3253 phenylacetate-coenzyme A ligase, putative
Query= SwissProt::Q72K16 (445 letters) >MicrobesOnline__882:208777 Length = 421 Score = 155 bits (392), Expect = 2e-42 Identities = 133/429 (31%), Positives = 194/429 (45%), Gaps = 45/429 (10%) Query: 8 ETLPREKLRALQEERLKRLVAYVYERVPFYRRLLDEAGVDPKGFRGLEDLPRIPFTKKTD 67 E L + R +LK L+AY Y ++ D A + F+ L DL IP KK + Sbjct: 15 EVLDESERRQYYLIQLKDLLAYAYRYSEDVKKRFDRAQFSVEKFKTLSDLKHIPILKKKE 74 Query: 68 LRDHYPFG-----LFAVPREEVARVHASSGTTGKPT-----VVGYTKNDLKVFAEVVARS 117 L G L E+ R+ S G P GYT+ + Sbjct: 75 LIFLQSMGPRLGGLLTKDLGELKRIFLSPGPIFDPEDRADDYWGYTE------------A 122 Query: 118 LAAAGARPGMMLHNAYGYGLFTGGLGLHGGAEALGMTVVPVSGGMTERQVMLIQDFRPEV 177 + G RPG + + Y L GL LG VVP Q+ ++Q R Sbjct: 123 FYSVGFRPGDLSQITFNYHLAPAGLMFEEPLRNLGCAVVPAGPSDASTQLDIMQKLRVSG 182 Query: 178 ISCTPSYAQTLAEEFRKRGVS-PEELSLEYAVLGAEPWTEAIRKQVDEGLGVKSTNIYGL 236 TPSY LA++ ++G++ ++L LE A + E +E +R Q+++ + YG Sbjct: 183 YVGTPSYLMHLAQKAEEKGLNLRKDLFLEVAFVTGERLSEKMRAQLEKKFDMVMRQGYGT 242 Query: 237 SEIIGPGVSNECVEERQGSHIWEDHFLPEVVDPDTGEPLPEGKVGVLVFTTLTKEAMPLL 296 +++ + EC + G HI F+ E+ PDTG PL +G+VG +V T K PL+ Sbjct: 243 ADV--GCIGYECFH-KTGLHIANRCFV-EICHPDTGIPLKDGEVGEIVVTAFNK-TYPLI 297 Query: 297 RYWTGDLTFLTYEACTCGRTHVRMGPILGRTDDMLIIRGVNVYPTQVEAVLLAIPEVVPH 356 R TGDL+++ C CGRT R+G I+GR D I+G+ VYP QVE V+ E V Sbjct: 298 RLATGDLSYIDRSPCLCGRTSPRLGSIVGRVDTTARIKGMFVYPHQVEQVMSRFEE-VKR 356 Query: 357 YQIVVRREGTLDEAELKVEVSEPFFREIGQEVLSDEVVEADHRLHALRERIARKIKDNVG 416 +QI V G +DE L +E S F RE D LH RE+I K++ ++ Sbjct: 357 WQIEVTNPGGIDEMTLLIEASN-FRRE-------------DELLHQFREKI--KLRPDLK 400 Query: 417 VTLKVTLLP 425 + TL P Sbjct: 401 ILTPGTLPP 409 Lambda K H 0.319 0.139 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 436 Number of extensions: 22 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 445 Length of database: 421 Length adjustment: 32 Effective length of query: 413 Effective length of database: 389 Effective search space: 160657 Effective search space used: 160657 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory