Align fumarylacetoacetase (EC 3.7.1.2) (characterized)
to candidate 206303 DVU0875 fumarylacetoacetate hydrolase family protein
Query= BRENDA::A0A076VF18 (308 letters) >MicrobesOnline__882:206303 Length = 259 Score = 126 bits (317), Expect = 5e-34 Identities = 84/233 (36%), Positives = 125/233 (53%), Gaps = 21/233 (9%) Query: 59 SPRVLTVQTLLSPLAPTDVPAIRGMGLQYSGDPAN-PQDKPPVACLFFKASQALAGPGDD 117 +P L+ TLL +AP+ V + GL Y G D P F KA A+ G G+ Sbjct: 33 APIPLSEITLLPVVAPSKVVCV---GLNYRGHAGELGMDVPDEPVFFLKAPTAIIGTGEP 89 Query: 118 IVLPRLARDEKNDYEVELCVVLGKDAKDVDEKDAMSFVGGYCVVNDVSSRGLCAKGGQWG 177 IVLP + DYE EL +V+GK +++ + A + G+ NDV++R + + G +G Sbjct: 90 IVLPPAVG--RVDYEGELALVVGKQCRNITPEQAREHIFGFTCANDVTARDIQKRDGLFG 147 Query: 178 MGKSYDTWCPFGPCLVSPSALGADPHKLTITTHVNGKLAQKGNTADLVLKIPELIARLSH 237 K YDT+CP GP + +AL DP LT+ T VNG++ Q+GNTAD+++ EL++ +S Sbjct: 148 RCKGYDTFCPVGPWI--ETAL-EDPGNLTLRTVVNGEVRQQGNTADMLVHPFELLSSISR 204 Query: 238 GTTLQAGSLILTGSPIALGRKAPGDAVEQSPFMKDGDEIRCFVEGCGTLINSV 290 TL G L+LTG+P +G + GDE+R ++ G L N V Sbjct: 205 VMTLLPGDLVLTGTPEGIGP------------IHAGDEVRVEIDEVGLLTNPV 245 Lambda K H 0.316 0.135 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 264 Number of extensions: 15 Number of successful extensions: 3 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 308 Length of database: 259 Length adjustment: 26 Effective length of query: 282 Effective length of database: 233 Effective search space: 65706 Effective search space used: 65706 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 47 (22.7 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory