GapMind for catabolism of small carbon sources

 

Aligments for a candidate for iorA in Desulfovibrio vulgaris Hildenborough

Align indolepyruvate ferredoxin oxidoreductase (subunit 2/2) (EC 1.2.7.8) (characterized)
to candidate 209309 DVU0374 pyruvate ferredoxin/flavodoxin oxidoreductase family protein

Query= BRENDA::Q6LZB6
         (578 letters)



>lcl|MicrobesOnline__882:209309 DVU0374 pyruvate
           ferredoxin/flavodoxin oxidoreductase family protein
          Length = 832

 Score =  222 bits (565), Expect = 5e-62
 Identities = 183/600 (30%), Positives = 290/600 (48%), Gaps = 46/600 (7%)

Query: 4   LMLGNEAVARGAYEAGVLVATAYPGTPSTEITEH-ISKYPE-INSEWSVNEKVALEVAIG 61
           ++ GN A A G   +G+     YPGTPSTE+ +  +S   + I   WSV+E VA+ +  G
Sbjct: 17  VLQGNIAFAAGCVRSGIHAVDGYPGTPSTEVIDKGLSNVQDMIKVGWSVSEAVAVSMGHG 76

Query: 62  SAIAGARTVVSMKHVGLNVAADPLMTVAYTGINAGLLII-VADDPSMHSSQNEQDTRYYG 120
            ++AG   +V+MK  GL  A DP  + A+   + G L+  +A D +  S+Q+  D R + 
Sbjct: 77  HSLAGEDCIVTMKIPGLFQAGDPFSSSAFFTEDRGALVYYLASDFTPSSTQHLVDPRPFI 136

Query: 121 IFSKIPVLEPSDSQECKDFVKLGLEISEKFDTPVILRLSTRVSHSQSLVELEE------- 173
                P+ EP + QE  +  ++  +IS ++ TPV++  S  + HS+ LV L E       
Sbjct: 137 RSCFTPIFEPRNHQEMHEAAEIAADISRQYKTPVVILASGTLCHSEGLVRLSEIRTRERV 196

Query: 174 KEKIELKPYDYNPSKYVSAPANAKKRRIFIEERLKELSNFADSSDVNKIEYANKKIGIIT 233
              + LK ++  P   V+A  N  K    + ER+  L++  + S +N  E  ++K+G+IT
Sbjct: 197 VSSVPLKAFNTLP---VTARRNYDK---VVTERMPALADMVEKSPLNVWERGSRKVGVIT 250

Query: 234 SGVAYNYAKEAV----SDASFLKFGMSYPLPEEKIKEFVQNCD-KVYVFEELEPIFEQKI 288
            GV     +E       D   L  G + PLP   I+EF  + +  VYV E+     ++++
Sbjct: 251 FGVGEMMVREVKQALGEDIDILSLGFTCPLPMNLIREFHASIEGDVYVVEDGYRYLQEEL 310

Query: 289 RSMGLNVIGKEIFPIVGELSSEIIRNALLNES--KIVIEKIEDLPQRPPVLCPGCHHRGP 346
              GL V GK     V E     I  ALL  S        +  LP R P++C GC +R  
Sbjct: 311 ERAGLAVKGKSPADTVTEWDPAGIA-ALLGYSLKSPAASDVAPLP-RAPMICAGCPYRLF 368

Query: 347 FYVLKKLKLH-----VAGDIGCYTLGGFEPLNAIDTTICMGASIGMAHGFEMARGKEFAK 401
              ++ +K         GDIGC TL  F  ++A+DT + MGA      GF +A   + A 
Sbjct: 369 GETVRSMKKRGKIEACFGDIGCNTLLYF--MDAMDTNVAMGAGEAHRAGFIVA-NPDKAA 425

Query: 402 KSVAVIGDSTFWHSGVTGLIDIVYNKGHSTVIILDNSITAMTGHQENPSTGKTLSGERTN 461
           K ++++GD T  HSG+    + ++       ++LDN+ TAMTG Q  P++   L+G+  N
Sbjct: 426 KCISLLGDGTECHSGMDATRNTIFRHIAGVKVVLDNNWTAMTGGQPGPTSPVNLAGQE-N 484

Query: 462 QIDFEALGRSIGINRICVVDAYDLK----ALEETIKEEVNAEEPSLIITKRPCVLIKGAK 517
             D +A  ++ G  ++ VV+ YD K    AL   +++  N E  ++++T   C+      
Sbjct: 485 TFDLQASLKAHGA-KVVVVNGYDRKGIRTALTSALEDAANGEFTTMVVT-GVCIRKMPKS 542

Query: 518 FDFKDYKIDPKLCTGCKLCLKAGCPAISFDGKVAKINDSLCVGC----GLCKDLCKFSAI 573
                  +D  LC  C  C    CP IS D +     ++LC GC      C  +C   AI
Sbjct: 543 AYGTRMTVDADLCKRCGQC--QICPGISADAEGLPSFNNLCSGCVSQNAACGQMCPVHAI 600


Lambda     K      H
   0.317    0.136    0.392 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 1056
Number of extensions: 69
Number of successful extensions: 9
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 2
Number of HSP's successfully gapped: 1
Length of query: 578
Length of database: 832
Length adjustment: 39
Effective length of query: 539
Effective length of database: 793
Effective search space:   427427
Effective search space used:   427427
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 54 (25.4 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory