Align Indolepyruvate oxidoreductase subunit IorB; IOR; Indolepyruvate ferredoxin oxidoreductase subunit beta; EC 1.2.7.8 (characterized)
to candidate 209309 DVU0374 pyruvate ferredoxin/flavodoxin oxidoreductase family protein
Query= SwissProt::P80911 (196 letters) >MicrobesOnline__882:209309 Length = 832 Score = 63.9 bits (154), Expect = 8e-15 Identities = 59/196 (30%), Positives = 94/196 (47%), Gaps = 17/196 (8%) Query: 5 IYVCGVGGQGIIKTSVIIGEAAMNEGM---NVVMSEIHGMAQRGGAVSTEIRFGDVRGSI 61 + + GVGGQG + ++ + A G NVV E HGMAQ GG V + G V + Sbjct: 639 VAIRGVGGQGNLFFGRVLTQLAFLAGYGDTNVVKGETHGMAQMGGPVISTFSCGKVVSPV 698 Query: 62 IPQGEADLVIAFEPLEALRA--LPKMSEDACVIVNTSKIPPFNLIKSPHPYPPLEEIIKT 119 + G AD +++ E E LR + + V++ +++ P+ + S YP + I+ T Sbjct: 699 LLPGTADCLVSMEMSEVLRPGYVGMLRPGGTVLLADTRVLPYGV--SEDAYPHRDAILGT 756 Query: 120 LEENAGRVRSFNGEKIAVEAGHILS--LNMVMLGA---AAATTGFPLGEETLIESMKNNL 174 L+ V + K A+E G N+VM+GA A GFP E +++++N Sbjct: 757 LD--GYNVIIIDVLKAALELGDPTGRIANVVMIGALSTLAPFDGFP--AELWLQALRNVS 812 Query: 175 P-PKLMEVNLRAFHEG 189 P P + N AF+ G Sbjct: 813 PKPAIWTANHAAFNVG 828 Lambda K H 0.317 0.136 0.389 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 392 Number of extensions: 22 Number of successful extensions: 1 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 196 Length of database: 832 Length adjustment: 31 Effective length of query: 165 Effective length of database: 801 Effective search space: 132165 Effective search space used: 132165 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 50 (23.9 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory