GapMind for catabolism of small carbon sources

 

Aligments for a candidate for paaK in Desulfovibrio vulgaris Hildenborough

Align Phenylacetate-coenzyme A ligase; Phenylacetyl-CoA ligase; PA-CoA ligase; EC 6.2.1.30 (characterized)
to candidate 208241 DVU2735 phenylacetate-coenzyme A ligase

Query= SwissProt::Q72K16
         (445 letters)



>lcl|MicrobesOnline__882:208241 DVU2735 phenylacetate-coenzyme A
           ligase
          Length = 432

 Score =  391 bits (1004), Expect = e-113
 Identities = 212/438 (48%), Positives = 282/438 (64%), Gaps = 15/438 (3%)

Query: 8   ETLPREKLRALQEERLKRLVAYVYERVPFYRRLLDEAGVDPKGFRGLEDLPRIPFTKKTD 67
           ET  R+++R  Q  RL+  V     R  FY   L +AG+ P   R L+DL RIPFT K D
Sbjct: 8   ETWNRDEIRQAQLVRLRNTVEQAM-RSSFYGATLRKAGITPDSIRSLDDLRRIPFTTKDD 66

Query: 68  LRDHYPFGLFAVPREEVARVHASSGTTGKPTVVGYTKNDLKVFAEVVARSLAAAGARPGM 127
           LR+ YP GL  VPR E+ R+HASSGTTG PTVV +T++DL  +A+++AR L   G R   
Sbjct: 67  LRNQYPDGLNCVPRTEMVRMHASSGTTGSPTVVYHTQSDLNAWADLMARCLHMVGVRRDD 126

Query: 128 MLHNAYGYGLFTGGLGLHGGAEALGMTVVPVSGGMTERQVMLIQDFRPEVISCTPSYAQT 187
           +  N  GYGLFTGGLGLH GAE LG   +P   G T+RQV L++DFR  V+   PSYA  
Sbjct: 127 VFQNMTGYGLFTGGLGLHYGAERLGCLTIPAGPGNTKRQVKLMRDFRTSVVHIIPSYALY 186

Query: 188 LAEEFRKRGVSPEELSLEYAVLGAEPWTEAIRKQVDEGLGVKSTNIYGLSEIIGPGVSNE 247
           LA    + G  P  L    AV+GAEP TE  R++++E LG+K+ N YGLSE+ GPGV+ E
Sbjct: 187 LAAAVEEGGEDPHALPPRIAVIGAEPHTEEARRRIEEMLGLKAFNSYGLSEMNGPGVAFE 246

Query: 248 CVEERQGSHIWEDHFLPEVVDPDTGEPLPEGKVGVLVFTTLTKEAMPLLRYWTGDLTFLT 307
           C E+  G H+WED ++ E++DP TGEP+P+G+VG LV TTL +  MP+LRY T DLT   
Sbjct: 247 CTEQ-NGMHVWEDAYIAEIIDPATGEPVPDGEVGELVMTTLCRRGMPVLRYRTRDLTRFL 305

Query: 308 YEACTCGRTHVRMGPILGRTDDMLIIRGVNVYPTQVEAVLLAIPEVVPHYQIVVRREGTL 367
              C CGR H R+  ++GR DDMLII+GVN+YP Q+E VL+A PEV  +Y IV+ RE  +
Sbjct: 306 PGECPCGRVHRRLDRMVGRADDMLIIKGVNIYPMQIEQVLMAFPEVGQNYLIVLEREEFI 365

Query: 368 DEAELKVEVSEPFFREIGQEVLSDEVVEADHRLHALRERIARKIKDNVGVTLKVTLLPPG 427
           D+ ++KVE+ +  F            VE    L  L++ IAR++KD + VT +V L+   
Sbjct: 366 DQIKVKVELRDEAF------------VEDMRVLQGLQKAIARRLKDEILVTPRVELVQNN 413

Query: 428 QAPRSEGGKLRRVLDLRK 445
             P++E GK +RVLDLR+
Sbjct: 414 SLPKAE-GKAQRVLDLRE 430


Lambda     K      H
   0.319    0.139    0.409 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 551
Number of extensions: 22
Number of successful extensions: 3
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 445
Length of database: 432
Length adjustment: 32
Effective length of query: 413
Effective length of database: 400
Effective search space:   165200
Effective search space used:   165200
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 51 (24.3 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, the preprint on GapMind for carbon sources, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory