Align Phenylacetate-coenzyme A ligase; Phenylacetyl-CoA ligase; PA-CoA ligase; EC 6.2.1.30 (characterized)
to candidate 209425 DVU0489 phenylacetate-coenzyme A ligase
Query= SwissProt::P76085 (437 letters) >MicrobesOnline__882:209425 Length = 432 Score = 327 bits (837), Expect = 6e-94 Identities = 187/426 (43%), Positives = 254/426 (59%), Gaps = 12/426 (2%) Query: 16 DELQALQTQRLKWTLKHAYENVPMYRRKFDAAGVHPDDFRELSDLRKFPCTTKQDLRDNY 75 ++L A+Q + L+WT++HAYE P YR K AAGV PDD L D+R+ P TT DLRD+Y Sbjct: 14 EKLHAIQLEGLRWTVRHAYEGSPRYRAKLRAAGVVPDDIVHLDDVRRLPFTTVADLRDDY 73 Query: 76 PFDTFAVPMEQVVRIHASSGTTGKPTVVGYTQNDIDNWANIVARSLRAAGGSPKDKIHVA 135 P +VP + VVRIHASSGTTGK ++ YTQ D+D +A +AR AG + +D++ +A Sbjct: 74 PLPLLSVPEKDVVRIHASSGTTGKRKILAYTQRDVDTFALQMARCYELAGLTQEDRVQIA 133 Query: 136 YGYGLFTGGLGAHYGAERLGATVIPMSGGQTEKQAQLIRDFQPDMIMVTPSYCLNLIEEL 195 GYGL+T G G G ER GA +P+ G E Q QL+ D + T S L + EE+ Sbjct: 134 VGYGLWTAGAGFQLGCERFGALTVPVGPGNLEMQLQLLTDLGVTCLCSTASMALLMAEEV 193 Query: 196 ERQ-LGGDASGCSLRVGVFGAEPWTQAMRKEIERRLGIT-ALDIYGLSEVMGPGVAMECL 253 ER L GD LR +FGAE + MR+ E +LG+ + DI G++E+ GPG +EC Sbjct: 194 ERHGLRGD---IRLRKVIFGAEAHSAKMRRTFEEKLGLEGSFDIAGMTEMYGPGTGLEC- 249 Query: 254 ETTDGPTIWEDHFYPEIVNPHDGTPLADGEHGELLFTTLTKEALPVIRYRTRDLTRLLPG 313 E DG W D F EI++P P+ GE GE++ T+L KEA P+IRYRTRDLTRL+PG Sbjct: 250 EAHDGIHYWADLFLVEILDPETLQPVEPGEVGEMVVTSLRKEASPLIRYRTRDLTRLIPG 309 Query: 314 T---ARTMRRMDRISGRSDDMLIIRGVNVFPSQLEEEIVKFEHLSPHYQLEVNRRGHLDS 370 T R + R D I GRSDDM+I RGVN++P Q+ + + F + Y +E+ R+ D Sbjct: 310 TCSCGRNIPRHDHILGRSDDMIIFRGVNIYPGQIADVLHLFPEVGSEYHIELTRKEGRDH 369 Query: 371 LSVKVELKESSLTLTHEQRCQVCHQLRHRIKSMVGISTDVMIVNCGSIPRSEGKACRVFD 430 + +KVE + + T HR K M +S V +V G +PRS K+ RV D Sbjct: 370 MLLKVERQPGAATGDERTLGVAIGNELHR-KLMARVS--VAVVAPGELPRSFAKSKRVTD 426 Query: 431 LRNIVG 436 LR + G Sbjct: 427 LRMVEG 432 Lambda K H 0.320 0.137 0.411 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 498 Number of extensions: 22 Number of successful extensions: 6 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 437 Length of database: 432 Length adjustment: 32 Effective length of query: 405 Effective length of database: 400 Effective search space: 162000 Effective search space used: 162000 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory