Align phenylacetaldehyde dehydrogenase (EC 1.2.1.39) (characterized)
to candidate 208821 DVU3294 aldehyde dehydrogenase (NADP) family protein
Query= BRENDA::P80668 (499 letters) >MicrobesOnline__882:208821 Length = 464 Score = 189 bits (481), Expect = 1e-52 Identities = 133/405 (32%), Positives = 203/405 (50%), Gaps = 8/405 (1%) Query: 76 AGRLPA-ERERILLRFADLVEQHSEELAQLETLEQGKSIAISRAFEVGCTLNWMRYTAGL 134 A R+PA ER IL R A L+ H+E L + E GK A S EV ++ +R+ A Sbjct: 41 AHRIPAHERLAILERLATLMRTHAEALVRDAVREGGKPWADS-VVEVERAIDGVRWAARE 99 Query: 135 TTKIAGKTLDLSIPLPQGARYQAWTRKEPVGVVAGIVPWNFPLMIGMWKVMPALAAGCSI 194 ++ G+ + + + P A A+T +EP GVV I +N P+ + + + +PA AAGC + Sbjct: 100 LAQLGGREVPMGLT-PASAGRLAFTVREPRGVVLAISAFNHPVNLIVHQAVPAFAAGCPV 158 Query: 195 VIKPSETTPLTMLRVAELASEAGIPDGVFNVVTGSGAVCGAALTSHPHVAKISFTGSTAT 254 ++KP+ TPL+ V L EAG+P+ + + A L + P VA +SF GS+ Sbjct: 159 LVKPASATPLSCRNVLRLMHEAGVPE-AWATMLPCAAATAEKLVADPRVAFLSFIGSSRV 217 Query: 255 GKGIARTAADHLTRVTLELGGKNPAIVLKDADPQWVIEGLMTGSFLNQGQVCAASSRIYI 314 G + A T LE GG P ++ AD + L+ G F + GQVC + R++ Sbjct: 218 GWHLRSKLAPGAT-CALEHGGAAPVVLDASADLDAALPLLLKGGFYHAGQVCVSVQRVFA 276 Query: 315 EAPLFDTLVSGFEQAVKSLQVGPGMSPVAQINPLVSRAHCDKVCSFLDDAQAQQAELIRG 374 T A L G M + PL+ +V ++++A+A ++ G Sbjct: 277 PHETARTFAERLAAAAAQLPTGDPMRHDTAVGPLIDPREVSRVHEWVEEARAGGGTVLCG 336 Query: 375 SNGPAGEGYYVAPTLVVNPDAKLRLTREEVFGPVVNLVRVADGEEALQLANDTEYGLTAS 434 P E Y +PT+V +P RL R EVFGPVV + D +EA+ AND + A+ Sbjct: 337 -GAPLSETLY-SPTVVYDPPQGCRLARNEVFGPVVAVFSTRDRDEAIARANDVPFIFQAA 394 Query: 435 VWTQNLSQALEYSDRLQAGTVWVNSHTLIDAN-LPFGGMKQSGTG 478 V+ +++ AL+ + RL A V VN HT + +PFGG +SG G Sbjct: 395 VFARDVDVALDTARRLNATGVMVNDHTAFRVDWMPFGGRGESGMG 439 Lambda K H 0.318 0.133 0.402 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 588 Number of extensions: 34 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 499 Length of database: 464 Length adjustment: 34 Effective length of query: 465 Effective length of database: 430 Effective search space: 199950 Effective search space used: 199950 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.7 bits) S2: 51 (24.3 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory