Align aldehyde dehydrogenase (NAD+) (EC 1.2.1.3) (characterized)
to candidate 208845 DVU3319 proline dehydrogenase/delta-1-pyrroline-5-carboxylate dehydrogenase
Query= BRENDA::P05091 (517 letters) >MicrobesOnline__882:208845 Length = 1006 Score = 232 bits (591), Expect = 6e-65 Identities = 154/478 (32%), Positives = 235/478 (49%), Gaps = 25/478 (5%) Query: 47 DAVSRKTFPTVNPST-GEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLL 105 D + PT NP+ EV+ + + + ++D A+ AA+ A WR + R L Sbjct: 520 DVTTADLIPTTNPAKPAEVVASICQAGRPEIDDAIAAAKKA---ALTWRDTSPADRAAYL 576 Query: 106 NRLADLIERDRTYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAG-----WADKYHGKT 160 R AD+ + L+A + ++ GK + +Y D+ + L YYA A + G+ Sbjct: 577 RRAADICRKRIWELSAWQVVEVGKQWDQAYH-DVTEGIDFLEYYAREMLRLGAPRRMGRA 635 Query: 161 IPIDGDFFSYTRHEPVGVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALY 220 F ++P G+ I PWNFP + A+ TGN V+ K + + Sbjct: 636 PGEHNHLF----YQPKGIAAVIAPWNFPFAIAIGMASAAIVTGNPVIFKPSSISSRIGYN 691 Query: 221 VANLIKEAGFPPGVVNIVPGFGPTAGAAIASHEDVDKVAFTGSTEIGRVIQ-----VAAG 275 +A + +EAG P GV N PG G + H D+ + FTGS E+G IQ V G Sbjct: 692 LAEVFREAGLPEGVFNYCPGRSSIMGDYLVEHPDISLICFTGSMEVGLRIQEKAAKVQPG 751 Query: 276 SSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDIYDEF 335 KRV E+GGK+ II DAD+D AV Q ++ F QGQ C A SR V + IYD F Sbjct: 752 QRQCKRVIAEMGGKNATIIDDDADLDEAVLQVLYSAFGFQGQKCSACSRVIVLDAIYDRF 811 Query: 336 VERSVARAKSRVVGNPFDSKTEQGPQVDETQFKKILGYINTGKQEGAKLLCGGGIAADRG 395 +ER V A S +G D GP D T K + YI ++EG LL + A+ G Sbjct: 812 IERLVKAASSIHIGPSEDPSNYMGPVADATLQKNVSDYIRIAEEEGRVLLKRTDLPAE-G 870 Query: 396 YFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANNSTYGLAAAVFTKDLDK 455 ++ T+ GD++ IA+EEIFGPV+ +++ T +E + AN + + L AVF++ + Sbjct: 871 CYVPLTIVGDIRPEHRIAQEEIFGPVLAVMRAATFDEALSIANGTRFALTGAVFSRSPEH 930 Query: 456 ANYLSQALQAGTVWVN--CYDVFGAQSPFGGYKMSGSGRELG--EYGLQAYTEVKTVT 509 + + + G +++N + PFGG+ MSG G + G +Y LQ + + + VT Sbjct: 931 LDKARREFRVGNLYLNKGSTGALVERQPFGGFAMSGVGSKTGGPDYLLQ-FMDPRVVT 987 Lambda K H 0.319 0.136 0.409 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 1181 Number of extensions: 63 Number of successful extensions: 5 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 517 Length of database: 1006 Length adjustment: 40 Effective length of query: 477 Effective length of database: 966 Effective search space: 460782 Effective search space used: 460782 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.8 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory