GapMind for catabolism of small carbon sources

 

Aligments for a candidate for pfor in Desulfovibrio vulgaris Hildenborough

Align aldehyde ferredoxin oxidoreductase (EC 1.2.7.5) (characterized)
to candidate 206111 DVU0687 aldehyde:ferredoxin oxidoreductase, tungsten-containing, putative

Query= BRENDA::Q8U1K3
         (627 letters)



>lcl|MicrobesOnline__882:206111 DVU0687 aldehyde:ferredoxin
           oxidoreductase, tungsten-containing, putative
          Length = 594

 Score =  153 bits (386), Expect = 2e-41
 Identities = 132/435 (30%), Positives = 202/435 (46%), Gaps = 27/435 (6%)

Query: 11  GWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEARGVEP---LSPENKLI 67
           G   R+L V+L +G  +V  +  E     +GG GLAA +   +A G+       P   LI
Sbjct: 12  GTASRVLHVDLESGASRVLLF--EGRPHHLGGSGLAAALY--DAYGLPESPAFDPRQPLI 67

Query: 68  FAAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPV 127
           FA GP +G   P   K+V   +SP TG + + + G   ++ LR AGYDAL++ G+A+   
Sbjct: 68  FAIGPLSGF-FPLMSKVVCGFRSPYTGEWAESHAGGRLALSLRFAGYDALMITGRARTLS 126

Query: 128 YIYIEDDNVSILSAEGLWGKTTFETERELKEIHGKNVG---VLTIGPAGENLVKYAVVIS 184
            + +    + I     L G+  F + + L+    ++ G    + IGPAGE  V +A    
Sbjct: 127 CLVVGSRRLEIHDVHYLRGQDVFTSGKYLRRYGKESSGHRSTVRIGPAGERGVTFACANV 186

Query: 185 QEGRAAGRPGMGAVMGSKKLKAVVIRGTKEIPVADKEELKKLSQEAYNEILNSPGYPFWK 244
              R  GR G GAVMG K LKA+V+ G   I + +  +  KL +E Y  +  +     + 
Sbjct: 187 DSFRHFGRLGAGAVMGGKNLKALVVTGDSGIELPEGRDYPKLYKEVYQSVTGTDMMQKYH 246

Query: 245 RQGTMAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTM-EGMKVQQRGCPYCNMPCGNVV 303
             GT   +   N   ALP RN           I G    E + ++Q  C  C + C ++ 
Sbjct: 247 DLGTAENLLVLNELKALPWRNLQATTDPAIDGISGERFAEQLLLRQTACAGCPVGCIHIG 306

Query: 304 L-------DAE--GQESELDYENVALLGSNLGIGKLNEVSVLNRIADEMGMDTISLGVSI 354
           L       D E   ++   DYE +   GS LG+   ++V  L    +++G+D +S GV++
Sbjct: 307 LLRQQFARDHEFLYKQVSYDYEPIFAQGSMLGLTNASDVLALLDETEKLGLDCMSAGVAL 366

Query: 355 AHVMEAVERGILKEGPT-----FGDFKGAKQLALDIAYRKGELGNLAAEGVKAMAEKLGT 409
           A V EA E+G++ E  T     FG+          +A    E      +GV   A+  G 
Sbjct: 367 AWVAEAFEKGVVTEKETLGPVHFGNVATFVAALHHLANGTSEFWQALGKGVLYAADIYGG 426

Query: 410 HDFAMHVKGLEVSGY 424
            DFA  V G E++GY
Sbjct: 427 ADFAC-VLGQEMAGY 440


Lambda     K      H
   0.316    0.137    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 1
Number of Hits to DB: 921
Number of extensions: 40
Number of successful extensions: 4
Number of sequences better than 1.0e-02: 1
Number of HSP's gapped: 1
Number of HSP's successfully gapped: 1
Length of query: 627
Length of database: 594
Length adjustment: 37
Effective length of query: 590
Effective length of database: 557
Effective search space:   328630
Effective search space used:   328630
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 53 (25.0 bits)

This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.

Links

Downloads

Related tools

About GapMind

Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer. Ublast hits may be split across two different proteins.

A candidate for a step is "high confidence" if either:

where "other" refers to the best ublast hit to a sequence that is not annotated as performing this step (and is not "ignored").

Otherwise, a candidate is "medium confidence" if either:

Other blast hits with at least 50% coverage are "low confidence."

Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. Gaps may be due to:

GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).

For more information, see the paper from 2019 on GapMind for amino acid biosynthesis, or view the source code.

If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know

by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory