Align aldehyde ferredoxin oxidoreductase (EC 1.2.7.5) (characterized)
to candidate 206111 DVU0687 aldehyde:ferredoxin oxidoreductase, tungsten-containing, putative
Query= BRENDA::Q8U1K3 (627 letters) >MicrobesOnline__882:206111 Length = 594 Score = 153 bits (386), Expect = 2e-41 Identities = 132/435 (30%), Positives = 202/435 (46%), Gaps = 27/435 (6%) Query: 11 GWWGRILRVNLTTGEVKVQEYPEEVAKKFIGGRGLAAWILWNEARGVEP---LSPENKLI 67 G R+L V+L +G +V + E +GG GLAA + +A G+ P LI Sbjct: 12 GTASRVLHVDLESGASRVLLF--EGRPHHLGGSGLAAALY--DAYGLPESPAFDPRQPLI 67 Query: 68 FAAGPFNGLPTPSGGKLVVAAKSPLTGGYGDGNLGTMASVHLRRAGYDALVVEGKAKKPV 127 FA GP +G P K+V +SP TG + + + G ++ LR AGYDAL++ G+A+ Sbjct: 68 FAIGPLSGF-FPLMSKVVCGFRSPYTGEWAESHAGGRLALSLRFAGYDALMITGRARTLS 126 Query: 128 YIYIEDDNVSILSAEGLWGKTTFETERELKEIHGKNVG---VLTIGPAGENLVKYAVVIS 184 + + + I L G+ F + + L+ ++ G + IGPAGE V +A Sbjct: 127 CLVVGSRRLEIHDVHYLRGQDVFTSGKYLRRYGKESSGHRSTVRIGPAGERGVTFACANV 186 Query: 185 QEGRAAGRPGMGAVMGSKKLKAVVIRGTKEIPVADKEELKKLSQEAYNEILNSPGYPFWK 244 R GR G GAVMG K LKA+V+ G I + + + KL +E Y + + + Sbjct: 187 DSFRHFGRLGAGAVMGGKNLKALVVTGDSGIELPEGRDYPKLYKEVYQSVTGTDMMQKYH 246 Query: 245 RQGTMAAVEWCNTNYALPTRNFSDGYFEFARSIDGYTM-EGMKVQQRGCPYCNMPCGNVV 303 GT + N ALP RN I G E + ++Q C C + C ++ Sbjct: 247 DLGTAENLLVLNELKALPWRNLQATTDPAIDGISGERFAEQLLLRQTACAGCPVGCIHIG 306 Query: 304 L-------DAE--GQESELDYENVALLGSNLGIGKLNEVSVLNRIADEMGMDTISLGVSI 354 L D E ++ DYE + GS LG+ ++V L +++G+D +S GV++ Sbjct: 307 LLRQQFARDHEFLYKQVSYDYEPIFAQGSMLGLTNASDVLALLDETEKLGLDCMSAGVAL 366 Query: 355 AHVMEAVERGILKEGPT-----FGDFKGAKQLALDIAYRKGELGNLAAEGVKAMAEKLGT 409 A V EA E+G++ E T FG+ +A E +GV A+ G Sbjct: 367 AWVAEAFEKGVVTEKETLGPVHFGNVATFVAALHHLANGTSEFWQALGKGVLYAADIYGG 426 Query: 410 HDFAMHVKGLEVSGY 424 DFA V G E++GY Sbjct: 427 ADFAC-VLGQEMAGY 440 Lambda K H 0.316 0.137 0.414 Gapped Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 1 Number of Hits to DB: 921 Number of extensions: 40 Number of successful extensions: 4 Number of sequences better than 1.0e-02: 1 Number of HSP's gapped: 1 Number of HSP's successfully gapped: 1 Length of query: 627 Length of database: 594 Length adjustment: 37 Effective length of query: 590 Effective length of database: 557 Effective search space: 328630 Effective search space used: 328630 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.6 bits) S2: 53 (25.0 bits)
This GapMind analysis is from Sep 17 2021. The underlying query database was built on Sep 17 2021.
Each pathway is defined by a set of rules based on individual steps or genes. Candidates for each step are identified by using ublast (a fast alternative to protein BLAST) against a database of manually-curated proteins (most of which are experimentally characterized) or by using HMMer with enzyme models (usually from TIGRFam). Ublast hits may be split across two different proteins.
A candidate for a step is "high confidence" if either:
Otherwise, a candidate is "medium confidence" if either:
Other blast hits with at least 50% coverage are "low confidence."
Steps with no high- or medium-confidence candidates may be considered "gaps." For the typical bacterium that can make all 20 amino acids, there are 1-2 gaps in amino acid biosynthesis pathways. For diverse bacteria and archaea that can utilize a carbon source, there is a complete high-confidence catabolic pathway (including a transporter) just 38% of the time, and there is a complete medium-confidence pathway 63% of the time. Gaps may be due to:
GapMind relies on the predicted proteins in the genome and does not search the six-frame translation. In most cases, you can search the six-frame translation by clicking on links to Curated BLAST for each step definition (in the per-step page).
For more information, see:
If you notice any errors or omissions in the step descriptions, or any questionable results, please let us know
by Morgan Price, Arkin group, Lawrence Berkeley National Laboratory